mpidb The Microbial Protein Interaction Database yuan-2008a-1 Rsd family proteins make simultaneous interactions with regions 2 and 4 of the primary sigma factor. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yuan A.H., Gregory B.D., Sharp J.S., McCleary K.D., Dove S.L., Hochschild A. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation rpod_pseae RNA polymerase sigma factor RpoD rpoD rpoDA Sigma-70 PA0576 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MSGKAQQQSRLKELIARGREQGYLTYAEVNDHLPEDISDPEQVEDIIRMINDMGINVFETAPDADALLLAEADTDEAAAEEAAAALAAVESDIGRTTDPVRMYMREMGTVELLTREGEIEIAKRIEEGIREVMSAIAQFPGTVDSILADYNRIVAEGGRLSDVLSGYIDPDDGSLPAEEVEPVNLKDDSADSKEKDDEEEESDDSSDSDDEGDGGPDPEEARLRFTAVSEQLDKAKKALKKHGRGSKQATAELTGLAELFMPIKLVPKQFDALVARVRSALEGVRAQERAIMQLCVRDARMPRADFLRLFPNHETDEKWVDSVLKSKPKYAEAIERLRDDILRNQQKLAALESEVELTVAEIKEINRAMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELGERMDMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDSTMQSPIEMATSESLKESTREVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEHLRSFLDE algq_pseae Transcriptional regulatory protein AlgQ algQ algR2 Alginate regulatory protein AlgR2 PA5255 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MLESCRNAQERWGGVHQLIDRWLHERQQLVQAFDALSGIQAPAPNAEELQHFCQLLLDYVSAGHFEVYEQLTAEGKAFGDQRGLELAKQIFPRLEAITESALNFNDRCDNGDCREGACLIAELKVLRQQLHERFELEDCLIEVLHNAHSQSGAEGSAVPV rpod_ecoli RNA polymerase sigma factor RpoD rpoD alt b3067 Sigma-70 JW3039 protein protein ecoli Escherichia coli (strain K12) MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKAKGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD rsd_ecoli Regulator of sigma D rsd b3995 JW3959 protein protein ecoli Escherichia coli (strain K12) MLNQLDNLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKESYMRLNEKALDDFCQSLVDYLSAGHFSIYERILHKLEGNGQLARAAKIWPQLEANTQQIMDYYDSSLETAIDHDNYLEFQQVLSDIGEALEARFVLEDKLILLVLDAARVKHPA rpod-rpod-5 1334224 n/a 1334225 unspecified role unspecified role bait bait region 4 sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false not-defined-1452349309 1334225 unspecified role unspecified role prey prey region 2 sufficient to bind sufficient binding region sufficient to bind range range range range false not-defined-868433034 1334226 unspecified role unspecified role ancillary ancillary physical association physical association false false false Fig. 5 rsd-rpod-2 1334224 not-defined-768531274 1334227 unspecified role unspecified role prey prey region 4 sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false not-defined-662571561 1334228 unspecified role unspecified role bait bait P0AFX4:p.[Gly14Glu;Tyr34Phe] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0AFX4:p.Tyr34Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P0AFX4:p.Gly14Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2B rsd-rpod-4 1334224 not-defined-662571561 1334228 unspecified role unspecified role bait bait P0AFX4:p.Asp142Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false P0AFX4:p.[Gly14Glu;Tyr34Phe] mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0AFX4:p.Tyr34Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false P0AFX4:p.Gly14Glu mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false not-defined-768531274 1334227 unspecified role unspecified role prey prey P00579:p.Ile388Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false P00579:p.Arg385Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region 2 sufficient to bind sufficient binding region sufficient to bind range range range range false P00579:p.Phe401Leu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2C, 3C rpod-rpod-4 1334224 n/a 1334227 unspecified role unspecified role prey prey P00579:p.Ile388Phe mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false region 2 sufficient to bind sufficient binding region sufficient to bind range range range range false not-defined-768531274 1334227 unspecified role unspecified role bait bait region 4 sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false P00579:p.Phe563Tyr mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false not-defined-662571561 1334228 unspecified role unspecified role ancillary ancillary physical association physical association false false false Fig. 4B