mpidb The Microbial Protein Interaction Database kataoka-2008-2 The carboxyl-terminal domain of TraR, a Streptomyces HutC family repressor, functions in oligomerization. ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kataoka M., Tanaka T., Kohno T., Kajiyama Y. mars@shinshu-u.ac.jp J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation kataoka-2008-1 The carboxyl-terminal domain of TraR, a Streptomyces HutC family repressor, functions in oligomerization. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kataoka M., Tanaka T., Kohno T., Kajiyama Y. mars@shinshu-u.ac.jp J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation g0kud5_9actn traR protein protein 9acto Streptomyces flavovirens MPYKAPEGKGYADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALGTVVEKNPIVITGADRLKRMEKNGMRYAPGETSSGHRVMTRSVHDPEICTALTLEPGDEAVIRIRVFRQDDKPTSVGVSVYPPHTVAAVPELGEDVRMVKQFDKLYSERTGREVVKGQRAAHARQASQDELNALRSTPPAHSAIAVMVTTVTFHDDEQALGYWEDVYAPGARVPMGE g0kud5-g0kud5-1 1334054 n/a 1334056 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1334056 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1334061 1334059 physical association physical association false false false Figs. 5, 6 g0kud5-g0kud5-2 1334054 n/a 1334056 unspecified role unspecified role bait bait n/a 1334056 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 5 g0kud5-g0kud5 1334055 n/a 1334056 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1334056 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli 1334071 1334068 physical association physical association false false false Fig. 4