UniProt UniProt http://www.uniprot.org han-2008-2 Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation han-2008-1 Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation han-2008-3 Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation han-2008-4 Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. orysj-root Rice (japonica) root root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. chongk@ibcas.ac.cn Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation han-2008-5 Rice ROOT ARCHITECTURE ASSOCIATED1 binds the proteasome subunit RPT4 and is degraded in a D-box and proteasome-dependent manner. brasx Brassica sp. (Mustard) bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Han Y., Cao H., Jiang J., Xu Y., Du J., Wang X., Yuan M., Wang Z., Xu Z., Chong K. the host organism for bifc was not in the list (NCBI_TaxID=3711) chongk@ibcas.ac.cn Rice seedling root cDNA. Plant Physiol. (0032-0889) 2008 Only protein-protein interactions imex curation q9fxt8_orysj OsRPT4 Os02g0199900 OSNPB_020199900 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MADGEDAAAARRRASVTEYRKKLLNCRELESRVSTVRENLKNAKKDFTKTEDDLKSLQSVGQIIGEVLRPLDNERFIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRTLPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKIVSSAIIDKYIGESARLIREMFGYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDELGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQARMEVLKIHAAGIAKHGEIDYEAVVKLAEGFNGADLRNVCTEAGMAAIRAERDYVVHEDFMKAVRKLNDAKKLESSAHYSADFGKE flp1_orysj Flowering-promoting factor 1-like protein 1 RAA1 FPF1-like protein 1 Protein ROOT ARCHITECTURE ASSOCIATED 1 OsJ_01159 P0462H08.5 LOC_Os01g15340 Os01g0257300 protein protein orysj Oryza sativa subsp. japonica (Rice) Rice MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVSSYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRDSFRVVDA raa1-rpt4 1282457 n/a 1282462 unspecified role unspecified role prey prey n/a 1282463 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1B raa1-rpt4 1282457 n/a 1282463 unspecified role unspecified role bait bait n/a 1282462 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1C rpt4-raa1 1282458 n/a 1282462 unspecified role unspecified role prey prey n/a 1282463 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1A raa1-rpt4 1282459 n/a 1282463 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1282462 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 2A raa1-rpt4-2 1282460 n/a 1282463 unspecified role unspecified role unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false orysj Oryza sativa subsp. japonica (Rice) Rice n/a 1282462 unspecified role unspecified role unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false orysj Oryza sativa subsp. japonica (Rice) Rice physical association physical association false false false Fig. 2B raa1-rpt4 1282461 n/a 1282463 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1282462 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2D