UniProt UniProt http://www.uniprot.org huang-2008-1 Human p32 is a novel FOXC1-interacting protein that regulates FOXC1 transcriptional activity in ocular cells. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Huang L., Chi J., Berry F.B., Footz T.K., Sharp M.W., Walter M.A. mwalter@ualberta.ca human trabecular meshwork cDNA Invest. Ophthalmol. Vis. Sci. (0146-0404) 2008 Only protein-protein interactions imex curation huang-2008-2 Human p32 is a novel FOXC1-interacting protein that regulates FOXC1 transcriptional activity in ocular cells. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Huang L., Chi J., Berry F.B., Footz T.K., Sharp M.W., Walter M.A. mwalter@ualberta.ca human trabecular meshwork cDNA Invest. Ophthalmol. Vis. Sci. (0146-0404) 2008 Only protein-protein interactions imex curation huang-2008-3 Human p32 is a novel FOXC1-interacting protein that regulates FOXC1 transcriptional activity in ocular cells. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Huang L., Chi J., Berry F.B., Footz T.K., Sharp M.W., Walter M.A. mwalter@ualberta.ca human trabecular meshwork cDNA Invest. Ophthalmol. Vis. Sci. (0146-0404) 2008 Only protein-protein interactions imex curation huang-2008-4 Human p32 is a novel FOXC1-interacting protein that regulates FOXC1 transcriptional activity in ocular cells. human-trabecular meshwork Homo sapiens trabecular meshwork trabecular_meshwork trabecular meshwork anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Huang L., Chi J., Berry F.B., Footz T.K., Sharp M.W., Walter M.A. mwalter@ualberta.ca human trabecular meshwork cDNA Invest. Ophthalmol. Vis. Sci. (0146-0404) 2008 Only protein-protein interactions imex curation huang-2008-5 Human p32 is a novel FOXC1-interacting protein that regulates FOXC1 transcriptional activity in ocular cells. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Huang L., Chi J., Berry F.B., Footz T.K., Sharp M.W., Walter M.A. mwalter@ualberta.ca human trabecular meshwork cDNA Invest. Ophthalmol. Vis. Sci. (0146-0404) 2008 Only protein-protein interactions imex curation huang-2008-6 Human p32 is a novel FOXC1-interacting protein that regulates FOXC1 transcriptional activity in ocular cells. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Huang L., Chi J., Berry F.B., Footz T.K., Sharp M.W., Walter M.A. mwalter@ualberta.ca human trabecular meshwork cDNA Invest. Ophthalmol. Vis. Sci. (0146-0404) 2008 Only protein-protein interactions imex curation c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ foxc1_human Forkhead box protein C1 Forkhead-related protein FKHL7 Forkhead-related transcription factor 3 FOXC1 FKHL7 FREAC3 protein protein human Homo sapiens Human MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAPPPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSLYSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAGGSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF foxc1-c1qbp 1323178 n/a 1323184 unspecified role unspecified role prey prey n/a 1323185 unspecified role unspecified role bait bait physical association physical association false false false S1 foxc1-c1qbp-1 1323179 n/a 1323184 unspecified role unspecified role prey prey n/a 1323185 unspecified role unspecified role bait bait physical association physical association false false false S2 foxc1-c1qbp-2 1323180 n/a 1323185 unspecified role unspecified role bait bait region his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1323184 unspecified role unspecified role prey prey cell lysate cell lysate region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false 1A foxc1-c1qbp-3 1323181 n/a 1323184 unspecified role unspecified role prey prey n/a 1323185 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B c1qbp-foxc1 1323182 n/a 1323185 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection xpress epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1323184 unspecified role unspecified role neutral component neutral component physical association physical association false false false 2 c1qbp-foxc1-1 1323183 n/a 1323184 unspecified role unspecified role bait bait region his L-histidine residue (2S)-2-amino-3-(1H-imidazol-4-yl)propanoic acid (2S)-2-amino-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 2-azanyl-3-(1H-imidazol-4-yl)propanoic acid 2-azanyl-3-(1H-imidazol-5-yl)propanoic acid [tautomer] 4-(2-amino-2-carboxyethyl)imidazole L-histidine alpha-amino-beta-(4-imidazole)propionic acid glyoxaline-5-alanine His undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1323185 unspecified role unspecified role prey prey cell lysate cell lysate Q12948:p.Phe112Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association false false false 3 and 6B