mpidb The Microbial Protein Interaction Database kern-2008-1 Characterization of the NapGH quinol dehydrogenase complex involved in Wolinella succinogenes nitrate respiration. wolsc Wolinella succinogenes comigration in sds comigration in sds page comigration in sds predetermined predetermined participant predetermined Kern M., Simon J. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation q7m9h3_wolsu NAPG WS0920 protein protein wolsu Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) Vibrio succinogenes MMDRRDFIFYGAGGTGALCAGFLGGHLLSGFLHSKEPLLRPPGALEESEFLATCIKCGQCVQVCPYYALSLLDIWHGSSLGTPYVDARERGCYLCDLYPCVLACPSGALSHETTEIKDVHMGMAYVKRIDACLAFLGEEVKAEAVSRMIHRKLHNDRERAVAERIADSVGNPCSLCADLCPHPSPLEAIAMVQLEGKKRAPQIRSGCVGCGVCQEVCPASESVIEIVPRVGYEELYGGQK q7mrz3_wolsu NAPH WS0923 protein protein wolsu Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) Vibrio succinogenes MNKYTTRATLAHVGFWDSFVSTRPDGKRRPSLRAWRYTVVISVHLLFLLSYYADIQILEGSISGSRMLGFHLADPFITLEVMSAYRGIPTNLLIGAVSIGGFYLFFGGRAFCSWVCPYGIFGEIGERLHQKLLSKKIIQERTFSPYWRYIFWIFFLSLSFFGGFLVFELFNVVGILSRFIIYGWSAAISWVILIFAFEVFFSQRAWCRYVCPLGTTYTMLGGASAMKIAWSEEQCNHCGVCSTVCIVPHVLDMTKKKSEGQKGGKHLVQSGDCTLCGRCIDVCHTDALGFENRLKKLL napg-naph 1333669 not-defined-2090405283 1333670 unspecified role unspecified role neutral component neutral component region strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1311892841 1333671 unspecified role unspecified role neutral component neutral component Q7MRZ3:p.[Cys207Ala;Cys211Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q7MRZ3:p.[Cys112Ala;Cys116Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q7MRZ3:p.[Cys238Ala;Cys241Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 6