mpidb The Microbial Protein Interaction Database robichon-2008-1 Artificial septal targeting of Bacillus subtilis cell division proteins in Escherichia coli: an interspecies approach to the study of protein-protein interactions in multiprotein complexes. ecoli Escherichia coli (strain K12) fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Robichon C., King G.F., Goehring N.W., Beckwith J. E. coli artificial septal targeting systemused for examining the interactions by fusing of one of the proteins (the “bait”) to ZapA, an E. coli protein targeted to mid-cell, and the second potentially interacting partner (the “prey”) to green fluorescent protein (GFP). A positive interaction between two test proteins in E. coli leads to septal localization of the GFP fusion construct, which can be detected by fluorescence microscopy. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation pbp2b_bacsu Penicillin-binding protein 2B Penicillin-binding protein B pbpB Penicillin-sensitive peptidoglycan D,D-transpeptidase BSU15160 protein protein bacsu Bacillus subtilis MPKKNKFMNRGAAILSICFALFFFVILGRMAYIQITGKANGEVLATKATEQHEKKRTIEASRGSILDRKGKVIAEDTATYKLIAILDKKMTTDVKHPQHVVNKEKTAEALSKVINLDKADILDILNKDAKQVEFGSAGRDITYSQKQKIEKMKLPGISFLRDTKRYYPNGVFASNLIGYAEVDEETNEISGAMGLEKVLDKYLKERDGYVTYESDKSGWELPNSKNKITAPKNGDNVYLTIDQKIQTFLEDSMTKVAQKYNPKKIMAAVVDPKTGKVLAMGQRPSFDPNKRDVTNYYNDLISYAYEPGSTMKIFTLAAAMQENVFNANEKYKSGTFEVGGAPVKDHNNGVGWGPTTYHDGVLRSSNVAFAKLAKEKLGYDRLNQYLHKFNFYQKTGIDLPGEVSSKINFKYEFDKASTAYGQASAVTPIQQIQAATAIANDGKMMKPYVIDHIVDPDKDKTIYQNKPESAGTPISASTAKKVRDILGEVVTSKIGTGQAYKIEGFDVAGKTGTAQIAGKGGYLDGTDNYIFSFMGMAPKDDPELLIYVAVQQPQLKAGQSSSDPVSEIFNPTMKNSLHYLNIEPTEKSDSDKEETKAQTMPDLTDQTVAAAQKKAKEENLTPIVIGSDVAVKEQYPKADEEVLTNQKVFLKTGGKIKMPDMTGWSRREVLQYGELAGIHIEVSGQGYAVSQSVKKDKEIKDKTVIKVKFKNPD divib_bacsu Cell division protein DivIB dds Cell division and sporulation protein BSU15240 divIB Division initiation protein DivIB protein protein bacsu Bacillus subtilis MNPGQDREKIVNIEERIPKIKEQRKQKANRRLISFIMLFFIMVLIIVYLQTPISKVSTISVTGNENVSKKEIIDLSDINSGDTEFWSLDKQKTEKKIQQNKLVKKAEISKSLPNKINIAIEEYKAIAYLEKDDVYYEVLENGSVLPNEVTPDDAGPILVNWTNAKKRSQMAKQLDALSNSLKQSISEIYYTPVKMDENRIKLYMNDGYVVTASIKTFADRMKTYPSIISQLSSNKKGIIHLEVATYFEEFGKNDKAAKKEDEN ftsl_bacsu Cell division protein FtsL yllD ylxB BSU15150 ftsL protein protein bacsu Bacillus subtilis MSNLAYQPEKQQRHAISPEKKVIVKKRASITLGEKVLLVLFAAAVLSVSLLIVSKAYAAYQTNIEVQKLEEQISSENKQIGDLEKSVADLSKPQRIMDIAKKNGLNLKDKKVKNIQE divic_bacsu Cell division protein DivIC divA BSU00620 divIC protein protein bacsu Bacillus subtilis MNFSRERTITEIQNDYKEQVERQNQLKKRRRKGLYRRLTVFGALVFLTAIVLASSVWSQTSSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKLKDEDYVTELARRDLFMSGDGEIIFNVEKKSK divib-pbpb-4 1333620 not-defined-540217275 1333621 unspecified role unspecified role prey prey c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false not-defined-1404388509 1333622 unspecified role unspecified role bait bait c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal zapa fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig. 3L divic-ftsl-2 1333620 not-defined-1039610273 1333623 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false not-defined-1465385836 1333624 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal zapa fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig. 3 ftsl-divic-1 1333620 not-defined-1465385836 1333624 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false not-defined-1039610273 1333623 unspecified role unspecified role bait bait n-terminal zapa fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Fig. 3