mpidb The Microbial Protein Interaction Database riepl-2008-1 Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. rhime Rhizobium meliloti Sinorhizobium meliloti fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation riepl-2008-2 Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation riepl-2008-3 Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation riepl-2008-4 Interaction of CheY2 and CheY2-P with the cognate CheA kinase in the chemosensory-signalling chain of Sinorhizobium meliloti. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Riepl H., Maurer T., Kalbitzer H.R., Meier V.M., Haslbeck M., Schmitt R., Scharf B. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation chea_rhime Chemotaxis protein CheA SMc03007 R00639 cheA protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MDMNEIKEIFFQECEEQLAELESGLLKLNDGDRDPETVNAVFRAVHSIKGGAGAFGLDDLVSFAHVFETTLDCVRSNRLEPNQDVLKVMLRSADVLADLTNAARDGGGVDEARSRQLIKELEALANGELPQAAAESAPKTTPAGVAPAAPVVNEEGFQPVAFSFDDFETGDEPTIEPSTYEIVFKPKSDLYSKGNDATLLLRDLSRLGEMSIHCNMDTLPPLDRMNPEEAYFSWKISLKTDKGEEAIRSVFEFAEWDCELDVALAGGTVGMDEDLPMQPVPFDLSILEDEAQAPAGEEDRAAASEGDSRNAAVAAAQTASNVLQMAQSTARVSPENARNSQSASAAQAAAQQAASAATPTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTNGTSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSVRLITEGENTEVDKTVIDKLAEPLTHMIRNAVDHGLETPEKRVAAGKNPEGTVRLTAKHRSGRIVIELADDGAGINREKVRQKAIDNDLIAADANLSDEEVDNLIFHAGFSTADKISDISGRGVGMDVVKRSIQALGGRINISSKPGQGSIFTMSLPLTLAVLDGMVVTVANQTLVVPLTAIVETLQPEASAIHSFGSSQRLISIRDSFCPLVDVGRILNFRGAQANPVEGVALLVESEGGGQRALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAIVAASRGQSLKPEMSLAAAG q52884_rhiml CDO24_06225 CN171_21380 CN211_06630 GHK53_05465 cheY2 CEJ86_01705 CN070_16445 protein protein rhime Rhizobium meliloti Sinorhizobium meliloti MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK chea-chey2 1333596 not-defined-1177104531 1333600 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-719275475 1333601 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2 chea-chey2-3 1333597 not-defined-1177104531 1333600 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli not-defined-719275475 1333601 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false Fig. 2 chea-chey2-5 1333598 not-defined-719275475 1333601 unspecified role unspecified role prey prey ecolx Escherichia coli not-defined-1177104531 1333600 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false 1333598 Fig. 4 chey2-chea 1333599 not-defined-719275475 1333601 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1177104531 1333600 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 4