mpidb The Microbial Protein Interaction Database lorenz-2008-1 HpaA from Xanthomonas is a regulator of type III secretion. xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lorenz C., Kirchner O., Egler M., Stuttmann J., Bonas U., Büttner D. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation lorenz-2008-2 HpaA from Xanthomonas is a regulator of type III secretion. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lorenz C., Kirchner O., Egler M., Stuttmann J., Bonas U., Büttner D. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation q3byl2_xanc5 hpaA XCV0420 protein protein xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) MIRRISPGTLRPSVSIEHGGSHHHGDHHADASGTSAGSPTDIAARAPRLRPAPPRRRRRGIRSLDGQEDEFDANEQEEIEAKRECALRGRVSVAITPAQSREHGQGDQHGGDRSTHTDDPQAGPWHSAAPAQLSDSIRTCIDAIVDRYVTRRDADPVAKRHALAAALVELRAVGVSHPAVAPLTATIWRLMREHLRAYDKATAAENLLALRTRLLELMPSELEPVPALRNFHLLLPLILLNAEKPRRRVDRTHAITRLNTLLIEQPQQAAQEVRP q3byl6_xanc5 hpaB XCV0416 protein protein xanc5 Xanthomonas campestris pv. vesicatoria (strain 85-10) MSSARFETIVRQMCEALDLPDVESVLDRRVLWVEGFEVYLHLPTPQPEDDVKEEALYLRIAYGLPPAGRTLTVFRLLLEANLSVYAQDQAQLGLNDDGVIVLIVRVPLDDDVDGAWICDLLAHYAEHGRYWNNNIFVAHDEMFEGIATGNYLWLRA hpab-hpaa 1333521 not-defined-1985274732 1333523 unspecified role unspecified role prey prey not-defined-545216191 1333524 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4A hpaa-hpab 1333522 not-defined-964429478 1333523 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli not-defined-2046025765 1333524 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 4B