UniProt UniProt http://www.uniprot.org heyd-2008-3 Differential isoform expression and interaction with the P32 regulatory protein controls the subcellular localization of the splicing factor U2AF26. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Heyd F., Carmo-Fonseca M., Moroy T. Tarik.Moroy@ircm.qc.ca mouse lymphoma cDNA J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation heyd-2008-1 Differential isoform expression and interaction with the P32 regulatory protein controls the subcellular localization of the splicing factor U2AF26. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Heyd F., Carmo-Fonseca M., Moroy T. Tarik.Moroy@ircm.qc.ca mouse lymphoma cDNA J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation heyd-2008-2 Differential isoform expression and interaction with the P32 regulatory protein controls the subcellular localization of the splicing factor U2AF26. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Heyd F., Carmo-Fonseca M., Moroy T. Tarik.Moroy@ircm.qc.ca mouse lymphoma cDNA J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation heyd-2008-4 Differential isoform expression and interaction with the P32 regulatory protein controls the subcellular localization of the splicing factor U2AF26. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Heyd F., Carmo-Fonseca M., Moroy T. Tarik.Moroy@ircm.qc.ca mouse lymphoma cDNA J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation u2af4_mouse Splicing factor U2AF 26 kDa subunit U2af1l4 U2af26 U2 auxiliary factor 26 U2 small nuclear RNA auxiliary factor 1-like protein 4 protein protein mouse Mus musculus Mouse MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIVLLNLYRNPQNTAQTADGSHCHVSDVEVQEHYDNFFEEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDAERAVAELNNRWFNGQAVHAELSPVTDFRESCCRQYEMGECTRGGFCNFMHLRPISRNLRRQLYGRGPRHRSPPRSHTGHRPRERNRRRSPDHRHGRF c1qbp_mouse Complement component 1 Q subcomponent-binding protein, mitochondrial Glycoprotein gC1qBP GC1q-R protein C1qbp Gc1qbp protein protein mouse Mus musculus Mouse MLPLLRCVPRSLGAASGLRTAIPAQPLRHLLQPAPRPCLRPFGLLSVRAGSARRSGLLQPPVPCACGCGALHTEGDKAFVEFLTDEIKEEKKIQKHKSLPKMSGDWELEVNGTEAKLLRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKAEEQEPERTSTPNFVVEVTKTDGKKTLVLDCHYPEDEIGHEDEAESDIFSIKEVSFQATGDSEWRDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKNQ c1qbp_chlae_protein Green monkey C1QBP protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey similar to human C1QBP/p32 protein UniProt AC Q07021 u2af2_chlae_protein Green monkey U2AF2 protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey similar to mouse U2af (UniProt AC P26369) c1qbp-u2af1l4-1 1323930 n/a 1323934 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 1323935 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 5A c1qbp-u2af1l4-2 1323930 n/a 1323934 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1323935 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 5B c1qbp-c1qbp_chlae_pr 1323930 n/a 1323934 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1323936 unspecified role unspecified role bait bait physical association physical association false false false 5A u2af1l4-c1qbp 1323931 n/a 1323934 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1323935 unspecified role unspecified role prey prey physical association physical association false false false no figure u2af1l4-c1qbp-1 1323932 n/a 1323934 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1323935 unspecified role unspecified role prey prey physical association physical association false false false 5c u2af1l4-u2af2_chlae_ 1323933 n/a 1323937 unspecified role unspecified role prey prey n/a 1323934 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false S4B A U2AF26/U2af1l4 construct with exon 7 deletion (aa162-192) also interacts.