mpidb The Microbial Protein Interaction Database riordan-2008-2 YscU cleavage and the assembly of Yersinia type III secretion machine complexes. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Riordan K.E., Schneewind O. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation riordan-2008-1 YscU cleavage and the assembly of Yersinia type III secretion machine complexes. yeren Yersinia enterocolitica pull down pull down western blot western blot Immuno blot Immuno blot Riordan K.E., Schneewind O. Mol. Microbiol. (0950-382X) 2008 Only protein-protein interactions imex curation sctl_yeren Type 3 secretion system stator protein sctL Yop proteins translocation protein L yscL protein protein yeren Yersinia enterocolitica MSQTCQTGYAYMQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAEKILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLAVRKILNDYDQVDMTLQVVREALALVSNQKQVVVRVNPDQAGTIREQIAKVHKDFPEISYLEVTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTEEE q56844_yeren yscU protein protein YEREN_W22703 Yersinia enterocolitica W22703 MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTTLIVALSAMLMGLSDYYFEHLSRLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLVTLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQFHQEIQSGNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQNIEKQHSEML ysck_yeren Yop proteins translocation protein K yscK protein protein yeren Yersinia enterocolitica MMENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQWRDSAHLNAALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLASPLQQLLTLVNQETLRQIIVQHELLIGPWPTNWQRPLPTEIESRTMIQSGLAFWLAAMEPQPQAWCKRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVMPTCSHLFK sctn_yeren Type 3 secretion system ATPase sctN Type III secretion ATPase Yop proteins secretion ATPase Ysc ATPase yscN protein protein yeren Yersinia enterocolitica MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRIGELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEHLLGQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCGEGQRMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRKAVLVVATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAGEPPTRRGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDGHIILSRKLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQIGEYQKGQDKEADQAIERIGAIRGWLCQGTHELSHFNETLNLLETLTQ q9za78_yeren yscQ protein protein YEREN_W22703 Yersinia enterocolitica W22703 MSLLTLPQAKLSELSLRQRLSHYRQNYLWEEGKLELTVSEPPSSLNCILQLQWKGTHFTLYCFGDDLANWLTPDLLGAPFSTLPKELQLALLERQTVFLPKLVCNDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILLSLRWHKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGMSHESDELNPKPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLLANGRLLGHGRLVEIQGRLGVRIERLTEVTIS q93kt7_yeren yscO ERS008652_03718 protein protein yeren Yersinia enterocolitica MIRRLHRVKVLRVERAEQAIKTQQACLQAAHRRHQEAVQTSQDYHLWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERERLTSCQKTLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA yscu-yscl-2 1333460 n/a 1333462 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-33478038 1333463 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q56844:p.Gly270Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 7 yscu-ysck 1333460 n/a 1333464 unspecified role unspecified role prey prey ecolx Escherichia coli not-defined-33478038 1333463 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeren Yersinia enterocolitica direct interaction direct interaction false false false Fig. 8B yscu-yscn 1333460 n/a 1333465 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-33478038 1333463 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeren Yersinia enterocolitica direct interaction direct interaction false false false Fig. 8B yscu-yscq-1 1333460 n/a 1333466 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-33478038 1333463 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false Fig. 8B yscu-ysck-1 1333461 n/a 1333462 unspecified role unspecified role prey prey n/a 1333466 unspecified role unspecified role prey prey n/a 1333464 unspecified role unspecified role prey prey not-defined-33478038 1333463 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1333467 unspecified role unspecified role prey prey association association false false false Fig. 5C yscu-yscq 1333461 n/a 1333462 unspecified role unspecified role prey prey n/a 1333466 unspecified role unspecified role prey prey n/a 1333467 unspecified role unspecified role prey prey not-defined-33478038 1333463 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q56844:p.Asn263Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 6 yscu-yscl-3 1333461 not-defined-33478038 1333463 unspecified role unspecified role bait bait Q56844:p.Gly270Asn mutation mutation certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1333467 unspecified role unspecified role prey prey association association false false false Fig. 7