mpidb The Microbial Protein Interaction Database letek-2008-1 DivIVA is required for polar growth in the MreB-lacking rod-shaped actinomycete Corynebacterium glutamicum. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Letek M., Ordóñez E., Vaquera J., Margolin W., Flärdh K., Mateos L.M., Gil J.A. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation div4a_strr6 Cell division protein DivIVA divIVA spr1505 protein protein strr6 Streptococcus pneumoniae (strain ATCC BAA-255 / R6) MPITSLEIKDKTFGTRFRGFDPEEVDEFLDIVVRDYEDLVRANHDKNLRIKSLEERLSYFDEIKDSLSQSVLIAQDTAERVKQAAHERSNNIIHQAEQDAQRLLEEAKYKANEILRQATDNAKKVAVETEELKNKSRVFHQRLKSTIESQLAIVESSDWEDILRPTATYLQTSDEAFKEVVSEVLGEPIPAPIEEEPIDMTRQFSQAEMEELQARIEVADKELSEFEAQIKQEVETPTPVVSPQVEEEPLLIQLAQCMKNQK div4a_bacsu Septum site-determining protein DivIVA ylmJ Cell division initiation protein DivIVA Minicell-associated protein DivIVA BSU15420 divIVA protein protein bacsu Bacillus subtilis MPLTPNDIHNKTFTKSFRGYDEDEVNEFLAQVRKDYEIVLRKKTELEAKVNELDERIGHFANIEETLNKSILVAQEAAEDVKRNSQKEAKLIVREAEKNADRIINESLSKSRKIAMEIEELKKQSKVFRTRFQMLIEAQLDLLKNDDWDHLLEYEVDAVFEEKE q9s2x4_strco Antigen 84 Cell wall synthesis protein Wag31 SCO2077 protein protein strco Streptomyces coelicolor A3(2) MPLTPEDVRNKQFTTVRLREGYDEDEVDAFLDEVEAELTRLLRENEDLRAKLAAATRAAAQNQQNMRKPPEPPQDQQHQQGPPQHQQGPPQQGGMPQQGMRGPGAPVPAGISGPPQQQMGGPMGGPPQLPSGAPQLPAGPGGQGGPQGPGPMGQGPGPMGQGPGPMQGQMGPGPMGGPMGGPQGPGGPGGPGMPGQGGPGGDSAARVLSLAQQTADQAIAEARSEANKIVGEARSRAEGLERDARAKADALERDAQEKHRVAMGSLESARATLERKVEDLRGFEREYRTRLKSYLESQLRQLETQADDSLAPPRTPATASLPPSPAPSMAPAGASAPSYGGNQSMGGGPGQSGPSYGGQQQMSPAMTQPMAPVRPQGPSPMGQAPSPMRGFLIDEDDN wag31_myctu Cell wall synthesis protein Wag31 wag31 Antigen 84 ag84 MTCY270.23 Rv2145c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNTAKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKADALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDSNADAGGFDQFNRGKN q8nnn8_corgl Antigen 84 Cell wall synthesis protein Wag31 Cgl2150 protein protein corgl Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) MPLTPADVHNVAFNKPPIGKRGYNEDEVDQFLDLVEDALVQFQEENEDLKQQVEELEAQVAGGTSSAASSSTAGAATAAASKSVDEAALRKEIEEKLRSEYASKLDDASKAAQKAQNDAKSAQDQLQRAQADAKAARDEAEKAKAEAKSAASSSTTKAAAVGAVGAGTGAAVATGAANVDTHMQAAKVLGLAQEMADRLTSEARSESKSMLDEAREAAEKQIEEANSTSNRTLEDARANAEKQIAEAQNRADTLVNEADAKAKNLVSEAEKKSAATLAASTSRAEAQIRQAEDKANALQADAERKHTETMAAVKEQQNALETRIAELQTFEREYRTRLKSLLEGQLEELNARGSSAPTNNKPSGE diviva-diviva-7 1333111 n/a 1333112 unspecified role unspecified role prey prey n/a 1333112 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 diviva-diviva-6 1333111 not-defined-1661648702 1333113 unspecified role unspecified role prey prey n/a 1333112 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 q9s2x4-q9s2x4 1333111 not-defined-417314078 1333114 unspecified role unspecified role bait bait not-defined-1230460359 1333114 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q9s2x4-ag84 1333111 not-defined-89118665 1333114 unspecified role unspecified role bait bait not-defined-1648223020 1333115 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q9s2x4-q8nnn8 1333111 not-defined-1253434428 1333116 unspecified role unspecified role prey prey not-defined-408876655 1333114 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 ag84-q9s2x4 1333111 not-defined-1823291516 1333115 unspecified role unspecified role bait bait not-defined-507975401 1333114 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ag84-ag84 1333111 not-defined-883135924 1333115 unspecified role unspecified role bait bait not-defined-549662402 1333115 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 ag84-q8nnn8 1333111 not-defined-1481067254 1333115 unspecified role unspecified role bait bait not-defined-789649591 1333116 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 diviva-diviva-8 1333111 not-defined-1553661763 1333113 unspecified role unspecified role bait bait n/a 1333112 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 diviva-diviva-4 1333111 not-defined-2064192807 1333113 unspecified role unspecified role prey prey not-defined-378808346 1333113 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4 q8nnn8-q8nnn8 1333111 not-defined-367605425 1333116 unspecified role unspecified role bait bait not-defined-1453265009 1333116 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q8nnn8-ag84 1333111 not-defined-1991932857 1333116 unspecified role unspecified role bait bait not-defined-877198157 1333115 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4 q8nnn8-q9s2x4 1333111 not-defined-1434329389 1333114 unspecified role unspecified role prey prey not-defined-1260131744 1333116 unspecified role unspecified role bait bait physical association physical association false false false Fig. 4