mpidb The Microbial Protein Interaction Database pilonieta-2008-1 The chaperone IpgC copurifies with the virulence regulator MxiE. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Pilonieta M.C., Munson G.P. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation ipgc_shifl Chaperone protein IpgC ipgC ippI CP0129 protein protein shifl Shigella flexneri MSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE mxie_shifl Transcriptional regulator MxiE mxiE CP0144 protein protein shifl Shigella flexneri MEGFFFVRNQNIKFSDNVNYHYRFNINSCAKFLAFWDYFSGALVEHSHAEKCIHFYHENDLRDSCNTESMLDKLMLRFIFSSDQNVSNALAMIRMTESYHLVLYLLRTIEKEKEVRIKSLTEHYGVSEAYFRSLCRKALGAKVKEQLNTWRLVNGLLDVFLHNQTITSAAMNNGYASTSHFSNEIKTRLGFSARELSNITFLVKKINEKI mxie-ipgc 1333026 not-defined-1560219331 1333027 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1416290352 1333028 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false Fig. 1 Authors report dentification of IpgC confirmed by anti-tag western blot.