mpidb The Microbial Protein Interaction Database singh-2008a-1 Identification of amino acid residues within the N-terminal domain of EspA that play a role in EspA filament biogenesis and function. ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Singh M.P., Shaw R.K., Knutton S., Pallen M.J., Crepin V.F., Frankel G. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation b7um94_eco27 espA E2348C_3936 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MDTSTTASVASANASTSTSMAYDLGSMSKDDVIDLFNKLGVFQAAILMFAYMYQAQSDLSIAKFADMNEASKESTTAQKMANLVDAKIADVQSSSDKNAKAQLPDEVISYINDPRNDITISGIDNINAQLGAGDLQTVKAAISAKANNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSLQYRTISGISLGK o52124_ecolx BFL24_25155 DAH23_17650 cesAB orf3 BON63_23780 C9E67_00525 L537_062 LDEC_054 LIHIT_058 UN91_09460 protein protein ecolx Escherichia coli MSIVSQTRNKELLDKKIRSEIEAIKKIIAEFDVVKESVNELSEKAKTDPQAAEKLNKLIEGYTYGEERKLYDSALSKIEKLIETLSPARSKSQSTMNQRNRNNRKIV espa-orf3-2 1332992 not-defined-574196713 1332993 unspecified role unspecified role bait bait B7UM94:p.Phe49Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false B7UM94:p.Phe42Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false B7UM94:p.Ile46Arg mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false not-defined-1582322398 1332994 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4B