mpidb The Microbial Protein Interaction Database chung-2007-1 The crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl Lewis X reveals the mechanism for cell binding and immune inhibition. ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chung M.C., Wines B.D., Baker H., Langley R.J., Baker E.N., Fraser J.D. Mol. Microbiol. (0950-382X) 2007 Only protein-protein interactions imex curation chung-2007-2 The crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl Lewis X reveals the mechanism for cell binding and immune inhibition. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Chung M.C., Wines B.D., Baker H., Langley R.J., Baker E.N., Fraser J.D. Mol. Microbiol. (0950-382X) 2007 Only protein-protein interactions imex curation sll11_staau Superantigen-like protein 11 sl11 protein protein staau Staphylococcus aureus STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL fcar_human Immunoglobulin alpha Fc receptor FCAR CD89 protein protein human Homo sapiens Human MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK a8e1u6_staau sl11 protein protein staau Staphylococcus aureus STLEVRSQATQDLKDYYKGQSFDLKNIGGYKEGNKVTFIYHNQQIDVTLTGKEKLEFNDDEEISNIDVFVVRENSDRSGITNSNGGITYSNKQDDIDNVKSVNMQITKKTSSNTETVTSSYYSIDKENISLKELDFKLRKHLIDNNGLYNTEPKDSKIKVTMKDGGFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL sl11-sl11-1 1332410 n/a 1332412 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false Table 1 1.7A Rworking = 0.19 Rfree = 0.24 sl11-p24071 1332411 not-defined-701191251 1332413 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. not-defined-1280940142 1332414 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false Fig. 1B