mpidb The Microbial Protein Interaction Database saad-2008-1 Protein-protein interactions within type III secretion system-dependent pili of Rhizobium sp. strain NGR234. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Saad M.M., Staehelin C., Broughton W.J., Deakin W.J. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation saad-2008-2 Protein-protein interactions within type III secretion system-dependent pili of Rhizobium sp. strain NGR234. rhisn Rhizobium sp. (strain NGR234) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Saad M.M., Staehelin C., Broughton W.J., Deakin W.J. J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation nolb_sinfn Nodulation protein NolB y4yE NGR_a00680 nolB protein protein rhisn Rhizobium sp. (strain NGR234) MMLPVTSISNSLPRVASSSFGEQAQFERALAQAADSMKNDTASTPVRTAPISPPMDVHRAAPTSPLEDRVLQTISSICPDSIVAAAAPNHKAALISGAPPGPSQKLPVEGGAGTERLGIPQGGHDFDVMVAGLRDLYNGVTQVALVSKGISGITSSVNKLLKEG nopx_sinfn Nodulation outer protein X Nodulation protein NolX nolX y4yC NGR_a00700 nopX protein protein rhisn Rhizobium sp. (strain NGR234) MSASNLLPMISSNPAQFAQASLAKAFAPRVAQGQQSVLSFEAMLSTNMLDRIGPLASREDLPPPDAESTLEDLQKDPLALLPPHMRAAIESMDQTPQSAVVIDDHYVAPAPIQSSRITWNGGSLTKPELQIVAVLNRHKDLCPLSWESLEAKANDPSTPPDLKAAIEALLQDPELFYAIGSQGDGRCGGKISAKDLSEFSKHHPQVAAFQESQAQSYAQNYIPSDSAENAQPSVMTENDALRELYRYSEYLPKNLSLADFKQIVDGEAKTGKCPPQVIAAAQYFVSHPEEWKQLYGGNIDKVHKEDFLQVASSSMSLTQAELDTLKTINSHQELFFGSGDLTRDKLASMADDKSLDPKVREAASQLLSDPLLFGLLNNAITGYKTHHGFFDFGGGHTVDSGNVSKEDFGRFYTNMTTANRTVQQPKFHVPETEAAQNAVADMKMGLADQPDIKSPKKNGGALMHVVDSVLRVGSKVLDWAATAVGVLSFIPGIGQVADLVSMTLACEAQAANLLRTAITGGNMKQALIEAGIGVAAQAVGLVSGPGVKLAIRNGLARKAIEEAATAGINLPLSMAQHYAEGYLNDLKARLAADHPA c4ald0_sinfn nopA NGR_a00550 protein protein rhisn Rhizobium sp. (strain NGR234) MSKIGTLTSAVGAGAAAGQNVAAKGAGAAAFQAQIAELAAVSAEATARSMLLRTVTTELQTTKKAADERVQ nolb-nopa-2 1332239 not-defined-1806739625 1332241 unspecified role unspecified role bait bait rhisn Rhizobium sp. (strain NGR234) not-defined-220140080 1332242 unspecified role unspecified role prey prey rhisn Rhizobium sp. (strain NGR234) n/a 1332243 unspecified role unspecified role prey prey rhisn Rhizobium sp. (strain NGR234) association association false false false Fig. 3C nopa-nolb 1332239 not-defined-1085364607 1332243 unspecified role unspecified role bait bait rhisn Rhizobium sp. (strain NGR234) not-defined-1563916142 1332241 unspecified role unspecified role prey prey rhisn Rhizobium sp. (strain NGR234) physical association physical association false false false Fig. 3A nolb-nopa 1332239 not-defined-1041573921 1332243 unspecified role unspecified role prey prey rhisn Rhizobium sp. (strain NGR234) not-defined-381785920 1332241 unspecified role unspecified role bait bait rhisn Rhizobium sp. (strain NGR234) physical association physical association false false false Fig. 3A nolb-nopa-1 1332240 n/a 1332242 unspecified role unspecified role neutral component neutral component not-defined-1563916142 1332241 unspecified role unspecified role neutral component neutral component not-defined-1085364607 1332243 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 2