mpidb The Microbial Protein Interaction Database dodd-2007-1 Functional comparison of the two Bacillus anthracis glutamate racemases. ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dodd D Reese JG, Louer CR, Ballard JD, Spies MA, Blanke SR J. Bacteriol. (0021-9193) 2007 Only protein-protein interactions imex curation 2010 a0a6l8pkk6_bacan Glutamate racemase racE2 murI GBAA_4717 protein protein bacan Bacillus anthracis MKLNRAIGVIDSGVGGLTVAKELIRQLPKERIIYLGDTARCPYGPRSREEVRQFTWEMTEHLLDLNIKMLVIACNTATAVVLEEMQKQLPIPVVGVIHPGSRTALKVTNTYHVGIIGTIGTVKSGAYEEALKSINNRVMVESLACPPFVELVESGNFESEMAYEVVRETLQPLKNTDIDTLILGCTHYPILGPVIKQVMGDKVQLISSGDETAREVSTILYHSKMLNEGEEQSDHLFLTTGKIGLFKEIASKWFGQPIENVKHIHLEKE race2-race2 1331864 not-defined-88964362 1331865 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false not-defined-158464165 1331865 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false figure 2c