UniProt UniProt http://www.uniprot.org xu-2006e-3 Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Xu C., Zhang J., Huang X., Sun J., Xu Y., Tang Y., Wu J., Shi Y., Huang Q., Zhang Q. yyshi@ustc.edu.cn J. Biol. Chem. (0021-9258) 2006 mimix curation xu-2006e-1 Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Xu C., Zhang J., Huang X., Sun J., Xu Y., Tang Y., Wu J., Shi Y., Huang Q., Zhang Q. yyshi@ustc.edu.cn J. Biol. Chem. (0021-9258) 2006 mimix curation xu-2006e-2 Solution structure of human peptidyl prolyl isomerase-like protein 1 and insights into its interaction with SKIP. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Xu C., Zhang J., Huang X., Sun J., Xu Y., Tang Y., Wu J., Shi Y., Huang Q., Zhang Q. yyshi@ustc.edu.cn J. Biol. Chem. (0021-9258) 2006 mimix curation ppil1_human Peptidyl-prolyl cis-trans isomerase-like 1 PPIL1 Rotamase PPIL1 CYPL1 CGI-124 UNQ2425/PRO4984 protein protein human Homo sapiens Human MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG snw1_human SNW domain-containing protein 1 Nuclear protein SkiP Ski-interacting protein Nuclear receptor coactivator NCoA-62 SKIIP SKIP SNW1 protein protein human Homo sapiens Human MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE cyclosporin_a Cyclosporin A small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) cyclosporin-ppil1 1330551 n/a 1330554 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1330555 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1330556 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false supplement. 4 cyclosporin-ppil1-1 1330551 n/a 1330556 unspecified role unspecified role neutral component neutral component n/a 1330554 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false supplement. 4 snw1-ppil1 1330552 n/a 1330555 unspecified role unspecified role bait bait n/a 1330554 unspecified role unspecified role prey prey physical association physical association false false false 5 snw1-ppil1-1 1330553 n/a 1330554 unspecified role unspecified role prey prey n/a 1330555 unspecified role unspecified role bait bait direct interaction direct interaction false false false supplement. fig. 5