UniProt UniProt http://www.uniprot.org andrade-2004-1 Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. rat-liver rattus norvegicus liver Rat liver liver far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Biochem. J. (0264-6021) 2004 mimix curation andrade-2004-2 Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Biochem. J. (0264-6021) 2004 mimix curation andrade-2004-3 Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Biochem. J. (0264-6021) 2004 mimix curation andrade-2004-4 Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Biochem. J. (0264-6021) 2004 mimix curation andrade-2004-5 Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules. rat-kidney Rat kidney kidney kidney [Renal] far western blotting far western blotting Affinity blotting Affinity blotting ms participant Identification by mass spectrometry ms participant Andrade J., Pearce S.T., Zhao H., Barroso M. barrosm@mail.amc.edu Biochem. J. (0264-6021) 2004 mimix curation g3p_rat Glyceraldehyde-3-phosphate dehydrogenase Gapdh 38 kDa BFA-dependent ADP-ribosylation substrate BARS-38 Gapd Peptidyl-cysteine S-nitrosylase GAPDH protein protein rat Rattus norvegicus (Rat) Rat MVKVGVNGFGRIGRLVTRAAFSCDKVDIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQAAEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE chp1_rat Calcineurin B homologous protein 1 Chp1 Calcineurin B-like protein Calcium-binding protein CHP Calcium-binding protein p22 Chp EF-hand calcium-binding domain-containing protein p22 protein protein rat Rattus norvegicus (Rat) Rat MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH g3p_rabit Glyceraldehyde-3-phosphate dehydrogenase GAPDH GAPD Peptidyl-cysteine S-nitrosylase GAPDH protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MVKVGVNGFGRIGRLVTRAAFNSGKVDVVAINDPFIDLHYMVYMFQYDSTHGKFHGTVKAENGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDHFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSATHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMVHMASKE chp1-gapdh-1 1319545 n/a 1319550 unspecified role unspecified role prey prey n/a 1319551 unspecified role unspecified role bait bait physical association physical association false false false 1A and 1B gapdh-chp1 1319546 n/a 1319551 unspecified role unspecified role prey prey n/a 1319550 unspecified role unspecified role bait bait physical association physical association false false false 3A chp1-gapdh-2 1319547 n/a 1319551 unspecified role unspecified role bait bait n/a 1319552 unspecified role unspecified role prey prey direct interaction direct interaction false false false 6A gapdh-chp1-1 1319548 n/a 1319552 unspecified role unspecified role bait bait n/a 1319551 unspecified role unspecified role prey prey direct interaction direct interaction false false false 6B, 6C, 7A and 7B chp1-gapdh-3 1319549 n/a 1319551 unspecified role unspecified role bait bait n/a 1319550 unspecified role unspecified role prey prey physical association physical association false false false 1A and 1B