IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ludes_meyers-2004-2 WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. in vitro In vitro protein array protein array predetermined predetermined participant predetermined Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation ludes_meyers-2004-3 WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting anti tag western anti tag western blot anti tag western Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Human brain cDNA library. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation ludes_meyers-2004-4 WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Human brain cDNA library. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation ludes_meyers-2004-1 WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting tag visualisation tag visualisation Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation ludes_meyers-2004-5 WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Human brain cDNA library. Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation ludes_meyers-2004-6 WWOX binds the specific proline-rich ligand PPXY: identification of candidate interacting proteins. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Ludes-Meyers J.H., Kil H., Bednarek A.K., Drake J., Bedford M.T., Aldaz C.M. Cancer - Interactions investigated in the context of cancer Interactions involving proteins-FBP11/21/30, YAP1 and PIN1 were not added since the species of origin could not be ascertained. maldaz@odin.mdacc.tmc.edu Oncogene (0950-9232) 2004 Only protein-protein interactions imex curation wwox_human WW domain-containing oxidoreductase WWOX FOR WOX1 Fragile site FRA16D oxidoreductase SDR41C1 Short chain dehydrogenase/reductase family 41C member 1 protein protein human Homo sapiens Human MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCNAATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRLSPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG f189b_human Protein FAM189B FAM189B C1orf2 COTE1 Protein COTE1 protein protein human Homo sapiens Human MMPSPSDSSRSLTSRPSTRGLTHLRLHRPWLQALLTLGLVQVLLGILVVTFSMVASSVTTTESIKRSCPSWAGFSLAFSGVVGIVSWKRPFTLVISFFSLLSVLCVMLSMAGSVLSCKNAQLARDFQQCSLEGKVCVCCPSVPLLRPCPESGQELKVAPNSTCDEARGALKNLLFSVCGLTICAAIICTLSAIVCCIQIFSLDLVHTLAPERSVSGPLGPLGCTSPPPAPLLHTMLDLEEFVPPVPPPPYYPPEYTCSSETDAQSITYNGSMDSPVPLYPTDCPPSYEAVMGLRGDSQATLFDPQLHDGSCICERVASIVDVSMDSGSLVLSAIGDLPGGSSPSEDSCLLELQGSVRSVDYVLFRSIQRSRAGYCLSLDCGLRGPFEESPLPRRPPRAARSYSCSAPEAPPPLGAPTAARSCHRLEGWPPWVGPCFPELRRRVPRGGGRPAAAPPTRAPTRRFSDSSGSLTPPGHRPPHPASPPPLLLPRSHSDPGITTSSDTADFRDLYTKVLEEEAASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVPTFQKVPLPSGPAPAHSLGDLKGSWPGRGLVTRFLQISRKAPDPSGTGAHGHKQVPRSLWGRPGRESLHLRSCGDLSSSSSLRRLLSGRRLERGTRPHSLSLNGGSRETGL litaf_human Lipopolysaccharide-induced tumor necrosis factor-alpha factor p53-induced gene 7 protein Small integral membrane protein of lysosome/late endosome LITAF PIG7 SIMPLE protein protein human Homo sapiens Human MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL wbp1_human WW domain-binding protein 1 WBP1 protein protein human Homo sapiens Human MARASSGNGSEEAWGALRAPQQQLRELCPGVNNQPYLCESGHCCGETGCCTYYYELWWFWLLWTVLILFSCCCAFRHRRAKLRLQQQQRQREINLLAYHGACHGAGPFPTGSLLDLRFLSTFKPPAYEDVVHRPGTPPPPYTVAPGRPLTASSEQTCCSSSSSCPAHFEGTNVEGVSSHQSAPPHQEGEPGAGVTPASTPPSCRYRRLTGDSGIELCPCPASGEGEPVKEVRVSATLPDLEDYSPCALPPESVPQIFPMGLSSSEGDIP shsa5_human Protein shisa-5 SHISA5 SCOTIN Scotin Putative NF-kappa-B-activating protein 120 PSEC0133 protein protein human Homo sapiens Human MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESCPDFCCGTCDDQYCCSDVLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL wbp1 WBP1 peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SGSGGTPPPPYTVG Similar to P97764 aas 170-179 wwox-fam189b 1322142 n/a 1322148 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1322149 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2a wwox-litaf 1322142 n/a 1322150 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1322148 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2a wwox-wbp1 1322142 n/a 1322151 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1322148 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 2a wwox-shsa5 1322142 n/a 1322152 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1322148 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2a wwox-wbp1-1 1322143 n/a 1322148 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1322151 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2b wwox-fam189b-1 1322143 n/a 1322149 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1322148 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2b wwox-litaf-1 1322143 n/a 1322148 unspecified role unspecified role bait bait purified purified ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1322150 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2b wwox-shsa5-1 1322143 n/a 1322148 unspecified role unspecified role bait bait purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1322152 unspecified role unspecified role prey prey cell lysate cell lysate region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 2b wwox-wbp1-2 1322144 n/a 1322148 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1322151 unspecified role unspecified role prey prey cell lysate cell lysate Q96G27:p.Tyr141Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 3a wwox-litaf-2 1322144 n/a 1322150 unspecified role unspecified role prey prey cell lysate cell lysate Q99732:p.[Tyr23Ala;Tyr61Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q99732:p.Tyr23Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1322148 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ww 1+2 domain-containing region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 3A wbp1-wwox 1322145 n/a 1322148 unspecified role unspecified role prey prey purified purified ww 1 domain-containing region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1322153 unspecified role unspecified role bait bait purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 1b wwox-litaf-3 1322146 n/a 1322148 unspecified role unspecified role bait bait purified purified Q9NZC7:p.[Tyr85Ala;Pro88Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ww 1 domain-containing region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false Q9NZC7:p.[Trp44Phe;Pro47Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1322150 unspecified role unspecified role prey prey cell lysate cell lysate human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells physical association physical association false false false 3b litaf-wwox 1322147 n/a 1322148 unspecified role unspecified role neutral component neutral component n/a 1322150 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 4i