UniProt UniProt http://www.uniprot.org ohtsuka-2004-1 ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Nat. Cell Biol. (1465-7392) 2004 mimix curation ohtsuka-2004-2 ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Nat. Cell Biol. (1465-7392) 2004 mimix curation ohtsuka-2004-3 ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Nat. Cell Biol. (1465-7392) 2004 mimix curation ohtsuka-2004-4 ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Nat. Cell Biol. (1465-7392) 2004 mimix curation ohtsuka-2004-5 ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Nat. Cell Biol. (1465-7392) 2004 mimix curation ohtsuka-2004-6 ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Nat. Cell Biol. (1465-7392) 2004 mimix curation ohtsuka-2004-7 ASC is a Bax adaptor and regulates the p53-Bax mitochondrial apoptosis pathway. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy immunostaining immunostaining Ohtsuka T., Ryu H., Minamishima Y.A., Macip S., Sagara J., Nakayama K.I., Aaronson S.A., Lee S.W. slee2@caregroup.harvard.edu Nat. Cell Biol. (1465-7392) 2004 mimix curation asc_human Apoptosis-associated speck-like protein containing a CARD PYD and CARD domain-containing protein Target of methylation-induced silencing 1 Caspase recruitment domain-containing protein 5 ASC CARD5 TMS1 PYCARD protein protein human Homo sapiens Human MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG pycard-bax 1317070 n/a 1317077 unspecified role unspecified role bait bait n/a 1317078 unspecified role unspecified role prey prey physical association physical association false false false 4a bax-pycard 1317071 n/a 1317077 unspecified role unspecified role prey prey n/a 1317078 unspecified role unspecified role bait bait physical association physical association false false false 4a bax-pycard-1 1317072 n/a 1317077 unspecified role unspecified role prey prey n/a 1317078 unspecified role unspecified role bait bait physical association physical association false false false 4a pycard-bax-1 1317073 n/a 1317077 unspecified role unspecified role bait bait n/a 1317078 unspecified role unspecified role prey prey physical association physical association false false false 4a bax-pycard-2 1317074 n/a 1317077 unspecified role unspecified role prey prey n/a 1317078 unspecified role unspecified role bait bait physical association physical association false false false 4a bax-pycard-4 1317075 n/a 1317078 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n/a 1317077 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection physical association physical association false false false 4b bax-pycard-5 1317076 n/a 1317077 unspecified role unspecified role neutral component neutral component n/a 1317078 unspecified role unspecified role neutral component neutral component physical association physical association false false false 4b