UniProt UniProt http://www.uniprot.org kuwako-2004-1 Necdin-related MAGE proteins differentially interact with the E2F1 transcription factor and the p75 neurotrophin receptor. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kuwako K., Taniura H., Yoshikawa K. Origin of E2F1 according to . sequence length of used constructs yoshikaw@protein.osaka-u.ac.jp J. Biol. Chem. (0021-9258) 2004 mimix curation kuwako-2004-3 Necdin-related MAGE proteins differentially interact with the E2F1 transcription factor and the p75 neurotrophin receptor. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kuwako K., Taniura H., Yoshikawa K. Origin of E2F1 according to . sequence length of used constructs yoshikaw@protein.osaka-u.ac.jp J. Biol. Chem. (0021-9258) 2004 mimix curation kuwako-2004-5 Necdin-related MAGE proteins differentially interact with the E2F1 transcription factor and the p75 neurotrophin receptor. mouse-n1e-115 Mus musculus neuroblastoma cells n1e-115 Mouse neuroblastoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kuwako K., Taniura H., Yoshikawa K. Origin of E2F1 according to . sequence length of used constructs yoshikaw@protein.osaka-u.ac.jp J. Biol. Chem. (0021-9258) 2004 mimix curation kuwako-2004-2 Necdin-related MAGE proteins differentially interact with the E2F1 transcription factor and the p75 neurotrophin receptor. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kuwako K., Taniura H., Yoshikawa K. Origin of E2F1 according to . sequence length of used constructs yoshikaw@protein.osaka-u.ac.jp J. Biol. Chem. (0021-9258) 2004 mimix curation kuwako-2004-4 Necdin-related MAGE proteins differentially interact with the E2F1 transcription factor and the p75 neurotrophin receptor. mouse-p19 Mus musculus embryonic teratocarcinoma cell line, epithelial-like, induced by retinoic acid p19 mouse embryonic teratocarcinoma cellline anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kuwako K., Taniura H., Yoshikawa K. Origin of E2F1 according to . sequence length of used constructs yoshikaw@protein.osaka-u.ac.jp J. Biol. Chem. (0021-9258) 2004 mimix curation e2f1_mouse Transcription factor E2F1 E2f1 protein protein mouse Mus musculus Mouse MAVAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQLPAAPPTGPRDSDVLLFATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFRGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTMVGIGKRLEGLTQDLQQLQESEQQLDHLMHICTTQLQLLSEDSDTQRLAYVTCQDLRSIADPAEQMVIVIKAPPETQLQAVDSSETFQISLKSKQGPIDVFLCPEESADGISPGKTSCQETSSGEDRTADSGPAGPPPSPPSTSPALDPSQSLLGLEQEAVLPRMGHLRVPMEEDQLSPLVAADSLLEHVKEDFSGLLPGEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF necd_mouse Necdin Ndn protein protein mouse Mus musculus Mouse MSEQSKDLSDPNFAAEVPDCEMQDSDAVPVGIPPPASLAANLAGPPCAPEGPMAAQQASPPPEERIEDVDPKILQQAAEEGRAHQPQSPARPIPAPPAPAQLVQKAHELMWYVLVKDQKRMVLWFPDMVKEVMGSYKKWCRSILRRTSVILARVFGLHLRLTNLHTMEFALVKALSPEELDRVALNNRMPMTGLLLMILSLIYVKGRGAREGAVWNVLRILGLRPWKKHSTFGDVRKIITEEFVQQNYLKYQRVPHIEPPEYEFFWGSRANREITKMQIMEFLARVFKKDPQAWPSRYREALEQARALREANLAAQAPRSSVSED nse3_mouse Non-structural maintenance of chromosomes element 3 homolog Nsmce3 MAGE-G1 antigen Mageg1 Ndnl2 Necdin-like protein 2 protein protein mouse Mus musculus Mouse MLQKPRGRGRPSTQADPERDWGGAGEEGPSTSRAAGGSSQGSRASLSAPTVGPRTQKQLELKVAELVQFLLIKDQKKIPIKRTDILKHVVGDYRDVYPNLLKLAAERLQYVFGYKLVELEPKSHSYILINMLEPVEADAEMRGDQGTPISGLLMIVLGLIFMKGNTITETEVWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYELQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPTQYCEALADEESRARPATASAPATSS tnr16_human Tumor necrosis factor receptor superfamily member 16 NGFR TNFRSF16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein human Homo sapiens Human MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSESTATSPV tnr16_mouse Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low affinity neurotrophin receptor p75NTR Low-affinity nerve growth factor receptor protein protein mouse Mus musculus Mouse MRRAGAACSAMDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDEETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVMGSSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV ndn-e2f1 1270372 n/a 1270377 unspecified role unspecified role prey prey n/a 1270378 unspecified role unspecified role bait bait physical association physical association false false false 3A ndnl2-e2f1 1270372 n/a 1270377 unspecified role unspecified role prey prey n/a 1270379 unspecified role unspecified role bait bait physical association physical association false false false 3A ndn-ngfr 1270372 n/a 1270378 unspecified role unspecified role bait bait n/a 1270380 unspecified role unspecified role prey prey physical association physical association false false false 6A ndnl2-ngfr 1270372 n/a 1270380 unspecified role unspecified role prey prey n/a 1270379 unspecified role unspecified role bait bait physical association physical association false false false 6A e2f1-ndn-1 1270373 n/a 1270378 unspecified role unspecified role prey prey n/a 1270377 unspecified role unspecified role bait bait direct interaction direct interaction false false false 3E e2f1-ndnl2-1 1270373 n/a 1270379 unspecified role unspecified role prey prey n/a 1270377 unspecified role unspecified role bait bait direct interaction direct interaction false false false 3E ngfr-ndn 1270373 n/a 1270378 unspecified role unspecified role prey prey n/a 1270380 unspecified role unspecified role bait bait direct interaction direct interaction false false false 6C ngfr-ndnl2 1270373 n/a 1270380 unspecified role unspecified role bait bait n/a 1270379 unspecified role unspecified role prey prey direct interaction direct interaction false false false 6C e2f1-ndn-2 1270374 n/a 1270378 unspecified role unspecified role prey prey n/a 1270377 unspecified role unspecified role bait bait physical association physical association false false false 9A Ngfr/p75NTR (Human protein has been used UniProt AC P08138) e2f1-ndnl2-2 1270374 n/a 1270379 unspecified role unspecified role prey prey n/a 1270377 unspecified role unspecified role bait bait physical association physical association false false false 9B Ngfr/p75NTR (Human protein has been used UniProt AC P08138) ngfr-ndn-1 1270374 n/a 1270378 unspecified role unspecified role prey prey n/a 1270380 unspecified role unspecified role bait bait physical association physical association false false false 9A ngfr-ndnl2-1 1270374 n/a 1270379 unspecified role unspecified role prey prey n/a 1270380 unspecified role unspecified role bait bait physical association physical association false false false 9B e2f1-ndn 1270375 n/a 1270377 unspecified role unspecified role bait bait n/a 1270378 unspecified role unspecified role prey prey physical association physical association false false false 3B e2f1-ndnl2 1270375 n/a 1270377 unspecified role unspecified role bait bait n/a 1270379 unspecified role unspecified role prey prey physical association physical association false false false 3B ndn-e2f1-1 1270376 n/a 1270381 unspecified role unspecified role prey prey n/a 1270377 unspecified role unspecified role prey prey n/a 1270378 unspecified role unspecified role bait bait association association false false false 7C ndnl2-e2f1-1 1270376 n/a 1270379 unspecified role unspecified role bait bait n/a 1270377 unspecified role unspecified role prey prey n/a 1270381 unspecified role unspecified role prey prey association association false false false 7D