UniProt UniProt http://www.uniprot.org kittlesen-2000-3 Interaction between complement receptor gC1qR and hepatitis C virus core protein inhibits T-lymphocyte proliferation. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kittlesen D.J., Chianese-Bullock K.A., Yao Z.Q., Braciale T.J., Hahn Y.S. Figure 4: the image and image legend labels do not correspond. 4c -image, 4b-image legend - (lane 7) shows NO binding to HCV core for the gC1qR aas 46-259 construct, yet figure 4D does show binding of aas 188-259. ysh5e@virginia.edu J. Clin. Invest. (0021-9738) 2000 Only protein-protein interactions imex curation kittlesen-2000-1 Interaction between complement receptor gC1qR and hepatitis C virus core protein inhibits T-lymphocyte proliferation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kittlesen D.J., Chianese-Bullock K.A., Yao Z.Q., Braciale T.J., Hahn Y.S. Figure 4: the image and image legend labels do not correspond. 4c -image, 4b-image legend - (lane 7) shows NO binding to HCV core for the gC1qR aas 46-259 construct, yet figure 4D does show binding of aas 188-259. ysh5e@virginia.edu human phytohemagglutinin-stimulated leukocyte library J. Clin. Invest. (0021-9738) 2000 Only protein-protein interactions imex curation kittlesen-2000-2 Interaction between complement receptor gC1qR and hepatitis C virus core protein inhibits T-lymphocyte proliferation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kittlesen D.J., Chianese-Bullock K.A., Yao Z.Q., Braciale T.J., Hahn Y.S. Figure 4: the image and image legend labels do not correspond. 4c -image, 4b-image legend - (lane 7) shows NO binding to HCV core for the gC1qR aas 46-259 construct, yet figure 4D does show binding of aas 188-259. ysh5e@virginia.edu J. Clin. Invest. (0021-9738) 2000 Only protein-protein interactions imex curation p27958-pro_0000037566 Core protein precursor protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGRTWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPTDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTVPASA 2 191 c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ p27958_pro-c1qbp-1 1323697 n/a 1323700 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1323701 unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false 2 and 3, 4d, 4c -image, 4b-image legend - (lane 8). 4c -image, 4b-image legend - (lane 7) shows NO binding to HCV core for the gC1qR aas 46-259 construct, yet figure 4D does show binding of aas 188-259. c1qbp-p27958_pro-3 1323697 n/a 1323700 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1323701 unspecified role unspecified role bait bait in vitro translated in vitro translated protein in vitro translated region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 4b-image /4c image legend - lane 4 p27958_pro-p27958_pr 1323698 n/a 1323700 unspecified role unspecified role bait bait core sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1323701 unspecified role unspecified role prey prey physical association physical association false false false 1b c1qbp-p27958_pro-2 1323699 n/a 1323700 unspecified role unspecified role prey prey core sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1323701 unspecified role unspecified role bait bait physical association physical association false false false 1c