IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ harris-1999-1 Interaction between the F plasmid TraA (F-pilin) and TraQ proteins. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Harris R.L., Sholl K.A., Conrad M.N., Dresser M.E., Silverman P.M. Mol. Microbiol. (0950-382X) 1999 Only protein-protein interactions imex curation pil1_ecoli Pilin traA F-pilin ECOK12F074 protein protein ecoli Escherichia coli (strain K12) MNAVLSVQGASAPVKKKSFFSKFTRLNMLRLARAVIPAAVLMMFFPQLAMAAGSSGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVFIAVGMAVVGL traq_ecoli Protein TraQ traQ ECOK12F094 protein protein ecoli Escherichia coli (strain K12) MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSREEREALEARQQAMMEGQQEGGHVSH traa-traq 1301328 n/a 1301329 biological role biological role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1301330 biological role biological role prey prey physical association physical association false false false Table 1. Analysis of TraA±TraQ interactions by yeast two-hybrid assay traq-traa 1301328 n/a 1301330 biological role biological role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1301329 biological role biological role prey prey domain iv region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 1301339 1301337 physical association physical association false false false Table 1 and figure 6