MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zhang-1998a-1 Identification and characterization of the human HCG V gene product as a novel inhibitor of protein phosphatase-1. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom predetermined predetermined participant predetermined Zhang J., Zhang L., Zhao S., Lee EY. Biochemistry (0006-2960) 1998 zhang-1998a-2 Identification and characterization of the human HCG V gene product as a novel inhibitor of protein phosphatase-1. in vitro In vitro phosphatase assay phosphatase assay predetermined predetermined participant predetermined Zhang J., Zhang L., Zhao S., Lee EY. Biochemistry (0006-2960) 1998 pp1a_rabit Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK pp1rb_human E3 ubiquitin-protein ligase PPP1R11 Protein phosphatase inhibitor 3 Hemochromatosis candidate gene V protein PPP1R11 HCGV TCTE5 Protein phosphatase 1 regulatory subunit 11 protein protein human Homo sapiens Human MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH ppp1ca-ppp1r11 1190450 pp1a_rabit 1190452 unspecified role unspecified role neutral component neutral component pp1rb_human 1190453 unspecified role unspecified role neutral component neutral component direct interaction direct interaction false false false mint fig.3 ppp1ca-ppp1r11-1 1190451 pp1rb_human 1190453 inhibitor inhibitor neutral component neutral component pp1a_rabit 1190452 enzyme enzyme neutral component neutral component enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false mint fig.6