IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ osada-1995-5 Association of erythroid transcription factors: complexes involving the LIM protein RBTN2 and the zinc-finger protein GATA1. mouse-c3h10t1_2 Mouse embryonic fibroblast C3H10T1_2 c3h10t1_2 Mouse mesenchymal stem cells 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Osada H., Grutz G., Axelson H., Forster A., Rabbitts TH. transiently cotransfected with GATA1 and RBTN2 2011-05-12: Kodiyar V; Centre for Cardiovascular Genetics, University College London Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 Only protein-protein interactions imex curation osada-1995-2 Association of erythroid transcription factors: complexes involving the LIM protein RBTN2 and the zinc-finger protein GATA1. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip autoradiography autoradiography Osada H., Grutz G., Axelson H., Forster A., Rabbitts TH. transiently cotransfected with GATA1 and RBTN2 2011-05-12: Kodiyar V; Centre for Cardiovascular Genetics, University College London Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 Only protein-protein interactions imex curation osada-1995-4 Association of erythroid transcription factors: complexes involving the LIM protein RBTN2 and the zinc-finger protein GATA1. in vitro In vitro pull down pull down autoradiography autoradiography Osada H., Grutz G., Axelson H., Forster A., Rabbitts TH. transiently cotransfected with GATA1 and RBTN2 2011-05-12: Kodiyar V; Centre for Cardiovascular Genetics, University College London Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 Only protein-protein interactions imex curation osada-1995-1 Association of erythroid transcription factors: complexes involving the LIM protein RBTN2 and the zinc-finger protein GATA1. mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line anti bait coip anti bait coimmunoprecipitation anti bait coip autoradiography autoradiography Osada H., Grutz G., Axelson H., Forster A., Rabbitts TH. transiently cotransfected with GATA1 and RBTN2 2011-05-12: Kodiyar V; Centre for Cardiovascular Genetics, University College London Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 Only protein-protein interactions imex curation osada-1995-3 Association of erythroid transcription factors: complexes involving the LIM protein RBTN2 and the zinc-finger protein GATA1. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip autoradiography autoradiography Osada H., Grutz G., Axelson H., Forster A., Rabbitts TH. transiently cotransfected with GATA1 and RBTN2 2011-05-12: Kodiyar V; Centre for Cardiovascular Genetics, University College London Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1995 Only protein-protein interactions imex curation tfe2_human Transcription factor E2-alpha Immunoglobulin enhancer-binding factor E12/E47 Transcription factor 3 Immunoglobulin transcription factor 1 Transcription factor ITF-1 Kappa-E2-binding factor TCF3 E2A ITF1 BHLHB21 Class B basic helix-loop-helix protein 21 protein protein human Homo sapiens Human MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFSSSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKERRVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVILNLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNPAGHM tal1_human T-cell acute lymphocytic leukemia protein 1 TAL1 SCL TCL5 Stem cell protein T-cell leukemia/lymphoma protein 5 BHLHA17 Class A basic helix-loop-helix protein 17 protein protein human Homo sapiens Human MTERPPSEAARSDPQLEGRDAAEASMAPPHLVLLNGVAKETSRAAAAEPPVIELGARGGPGGGPAGGGGAARDLKGRDAATAEARHRVPTTELCRPPGPAPAPAPASVTAELPGDGRMVQLSPPALAAPAAPGRALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRIFTNSRERWRQQNVNGAFAELRKLIPTHPPDKKLSKNEILRLAMKYINFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR rbtn2_mouse Rhombotin-2 Lmo2 Rbtn-2 Rbtn2 Rhom-2 Cysteine-rich protein TTG-2 LIM domain only protein 2 T-cell translocation protein 2 protein protein mouse Mus musculus Mouse MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGII gata1_mouse Erythroid transcription factor Gata1 Gf-1 Eryf1 GATA-binding factor 1 NF-E1 DNA-binding protein protein protein mouse Mus musculus Mouse MDFPGLGALGTSEPLPQFVDSALVSSPSDSTGFFSSGPEGLDAASSSTSPNAATAAASALAYYREAEAYRHSPVFQVYPLLNSMEGIPGGSPYASWAYGKTALYPASTVCPSHEDAPSQALEDQEGKSNNTFLDTLKTERLSPDLLTLGTALPASLPVTGSAYGGADFPSPFFSPTGSPLSSAAYSSPKFHGSLPLAPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRMIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRGSNLAGAGAAEGPAGGFMVVAGSSSSGNCGEVASGLALGTAGTAHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTTSFPTGPAPTTSSTSVIAPLSS gata2_human Endothelial transcription factor GATA-2 GATA-binding protein 2 GATA2 protein protein human Homo sapiens Human MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG tal1-tcf3-1 1145295 n/a 1145300 unspecified role unspecified role prey prey n/a 1145301 unspecified role unspecified role bait bait physical association physical association false false false 3 tal1-rbtn2-3 1145295 n/a 1145302 unspecified role unspecified role prey prey n/a 1145301 unspecified role unspecified role bait bait physical association physical association false false false 3 rbtn2-tal1 1145295 n/a 1145302 unspecified role unspecified role bait bait n/a 1145301 unspecified role unspecified role prey prey physical association physical association false false false 3 rbtn2-gata1-1 1145295 n/a 1145303 unspecified role unspecified role prey prey n/a 1145302 unspecified role unspecified role bait bait physical association physical association false false false 3 rbtn2-gata2 1145295 n/a 1145304 unspecified role unspecified role prey prey n/a 1145302 unspecified role unspecified role bait bait physical association physical association false false false 3 tal1-gata1 1145295 n/a 1145303 unspecified role unspecified role prey prey n/a 1145301 unspecified role unspecified role bait bait n/a 1145302 unspecified role unspecified role ancillary ancillary physical association physical association false false false 4 tal1-gata2 1145295 n/a 1145302 unspecified role unspecified role ancillary ancillary n/a 1145301 unspecified role unspecified role bait bait n/a 1145304 unspecified role unspecified role prey prey physical association physical association false false false 4 tcf3-gata1 1145295 n/a 1145300 unspecified role unspecified role bait bait n/a 1145302 unspecified role unspecified role ancillary ancillary n/a 1145301 unspecified role unspecified role ancillary ancillary n/a 1145303 unspecified role unspecified role prey prey physical association physical association false false false 4 tcf3-gata2 1145295 n/a 1145301 unspecified role unspecified role ancillary ancillary n/a 1145300 unspecified role unspecified role bait bait n/a 1145302 unspecified role unspecified role ancillary ancillary n/a 1145304 unspecified role unspecified role prey prey physical association physical association false false false 4 gata2-rbtn2-2 1145296 n/a 1145302 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1145304 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig 1C, 1E Peptide used to raise anti-GATA2 inhibited the interaction. rbtn2-gata1 1145296 n/a 1145302 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1145303 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig 1C, 1E Peptide used to raise anti-RBTN2 antibodies inhibited interaction. gata1-rbtn2-4 1145296 n/a 1145303 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1145302 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig 1C gata2-rbtn2 1145297 n/a 1145302 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1145304 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2B tal1-rbtn2-2 1145297 n/a 1145302 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1145301 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bhlh region sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2A The coordinates of the bHLH region are not given n the paper so have been inferred from the UniProtKB entry. gata1-rbtn2-1 1145298 n/a 1145303 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1145302 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig 1A gata1-rbtn2-3 1145299 n/a 1145302 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1145303 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig 1D