IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yamamoto-2011-2 NCoR1 Is a Conserved Physiological Modulator of Muscle Mass and Oxidative Function. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Yamamoto H., Williams E.G., Mouchiroud L., Canto C., Fan W., Downes M., Heligon C., Barish G.D., Desvergne B., Evans R.M., Schoonjans K., Auwerx J. Further details of constructs obtained from the authors. admin.auwerx@epfl.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation yamamoto-2011-1 NCoR1 Is a Conserved Physiological Modulator of Muscle Mass and Oxidative Function. mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Yamamoto H., Williams E.G., Mouchiroud L., Canto C., Fan W., Downes M., Heligon C., Barish G.D., Desvergne B., Evans R.M., Schoonjans K., Auwerx J. Further details of constructs obtained from the authors. admin.auwerx@epfl.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation yamamoto-2011-3 NCoR1 Is a Conserved Physiological Modulator of Muscle Mass and Oxidative Function. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Yamamoto H., Williams E.G., Mouchiroud L., Canto C., Fan W., Downes M., Heligon C., Barish G.D., Desvergne B., Evans R.M., Schoonjans K., Auwerx J. Further details of constructs obtained from the authors. admin.auwerx@epfl.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation yamamoto-2011-4 NCoR1 Is a Conserved Physiological Modulator of Muscle Mass and Oxidative Function. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Yamamoto H., Williams E.G., Mouchiroud L., Canto C., Fan W., Downes M., Heligon C., Barish G.D., Desvergne B., Evans R.M., Schoonjans K., Auwerx J. Further details of constructs obtained from the authors. admin.auwerx@epfl.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation yamamoto-2011-5 NCoR1 Is a Conserved Physiological Modulator of Muscle Mass and Oxidative Function. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yamamoto H., Williams E.G., Mouchiroud L., Canto C., Fan W., Downes M., Heligon C., Barish G.D., Desvergne B., Evans R.M., Schoonjans K., Auwerx J. Further details of constructs obtained from the authors. admin.auwerx@epfl.ch Cell (0092-8674) 2011 Only protein-protein interactions imex curation ncor1_mouse Nuclear receptor corepressor 1 Ncor1 Rxrip13 Retinoid X receptor-interacting protein 13 protein protein mouse Mus musculus Mouse MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSARHQQEFAVPDYRSSHLEVSQASQLLQQQQQQQLRRRPSLLSEFHPGSDRPQERRSGYEQFHPGPSPVDHDSLESKRPRLEQVSDSHFQRISAAVLPLVHTLPEGLRSSANAKKDPAFGVKHEAPSSPLSGQPCGDDQNASPSKLSKEELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIYDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHARKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINMNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYLTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKDDKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRGKGRVTRSMTSEAAAANAAAAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEAQCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDPEMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADEGVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNLLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLSSHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYEAVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESFEDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVVERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQNTISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPIVSHSPFDPHHRSSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTILNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTPPMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERERERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQESPSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQASTSTFQTSPSALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKLINKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD ucp3_mouse_gene gene gene mouse Mus musculus Mouse h4_mouse Histone H4 H4c11 H4c12 H4c14 H4c2 H4c3 H4c4 H4c6 H4c8 H4c9 H4f16 Hist1h4a Hist4h4 Hist1h4b Hist1h4c Hist1h4d Hist1h4f Hist1h4h Hist1h4i Hist1h4j Hist1h4k Hist2h4a Hist2h4 Hist1h4m H4-53 H4-12 H4c1 protein protein mouse Mus musculus Mouse MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG pdk4_mouse_gene [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial gene gene gene mouse Mus musculus Mouse myg_mouse_gene Myoglobin gene gene gene mouse Mus musculus Mouse kcrm_mouse_gene Mouse Creatine kinase M-type gene gene gene mouse Mus musculus Mouse Creatine kinase M-type gtr4_mouse_gene Solute carrier family 2, facilitated glucose transporter member 4 gene gene gene mouse Mus musculus Mouse pdk4_human_gene [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4, mitochondrial gene gene gene human Homo sapiens Human err1_human Steroid hormone receptor ERR1 Estrogen-related receptor alpha Estrogen receptor-like 1 Nuclear receptor subfamily 3 group B member 1 ESRRA ERR1 ESRL1 NR3B1 protein protein human Homo sapiens Human MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEAMMD ppard_mouse Peroxisome proliferator-activated receptor delta Ppard Nr1c2 Pparb Peroxisome proliferator-activated receptor beta Nuclear receptor subfamily 1 group C member 2 Nuclear hormone receptor 1 protein protein mouse Mus musculus Mouse MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMGCDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKHIYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEISVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLKKTESETLLHPLLQEIYKDMY ncor1-ucp3-1 1246158 n/a 1246163 unspecified role unspecified role bait bait n/a 1246164 unspecified role unspecified role prey prey peroxisome proliferator response elements region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5B PPARbeta/delta agonist (GW501516). hist1h4h-ucp3-1 1246158 n/a 1246165 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246164 unspecified role unspecified role prey prey peroxisome proliferator response elements region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5C hist1h4h-pdk4 1246158 n/a 1246166 unspecified role unspecified role prey prey nr1/2 response elements region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246165 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5G ncor1-myg 1246158 n/a 1246163 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246167 unspecified role unspecified role prey prey mef2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6F PPARbeta/delta agonist (GW501516). hist1h4h-myg 1246158 n/a 1246165 unspecified role unspecified role bait bait lys-17 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false n/a 1246167 unspecified role unspecified role prey prey mef2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6G PPARbeta/delta agonist (GW501516). hist1h4h-kcrm 1246158 n/a 1246165 unspecified role unspecified role bait bait lys-17 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false n/a 1246168 unspecified role unspecified role prey prey mef2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Supp. Fig. 6F PPARbeta/delta agonist (GW501516). hist1h4h-gtr4 1246158 n/a 1246169 unspecified role unspecified role prey prey mef2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246165 unspecified role unspecified role bait bait lys-17 naclys N-acetylated L-lysine NAcLys certain certain sequence position certain certain certain sequence position certain false association association false false false Supp. Fig. 6F PPARbeta/delta agonist (GW501516). ncor1-pdk4-2 1246158 n/a 1246166 unspecified role unspecified role prey prey nr1_2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246163 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5F PPARbeta/delta agonist (GW501516). ncor1-ucp3 1246159 n/a 1246164 unspecified role unspecified role prey prey peroxisome proliferator response element region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246163 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5B ncor1-pdk4 1246159 n/a 1246166 unspecified role unspecified role prey prey nr1_2 region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246163 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5F hist1h4h-ucp3 1246160 n/a 1246164 unspecified role unspecified role prey prey peroxisome proliferator response elements region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246165 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5C hist1h4h-pdk4-1 1246160 n/a 1246166 unspecified role unspecified role prey prey nr1/2 response elements region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246165 unspecified role unspecified role bait bait region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5G ncor1-pdk4-1 1246161 n/a 1246170 unspecified role unspecified role prey prey err response element binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246163 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5H esrra-pdk4 1246161 n/a 1246171 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246170 unspecified role unspecified role prey prey err response element binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 5H ncor1-ppard 1246162 n/a 1246172 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1246163 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5D