IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bouchoux-2011-1 A Quantitative Model for Ordered Cdk Substrate Dephosphorylation during Mitotic Exit. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bouchoux C., Uhlmann F. frank.uhlmann@cancer.org.uk Cell (0092-8674) 2011 Only protein-protein interactions imex curation bouchoux-2011-2 A Quantitative Model for Ordered Cdk Substrate Dephosphorylation during Mitotic Exit. in vitro In vitro protein kinase assay protein kinase assay ms participant Identification by mass spectrometry ms participant Bouchoux C., Uhlmann F. frank.uhlmann@cancer.org.uk Cell (0092-8674) 2011 Only protein-protein interactions imex curation bouchoux-2011-3 A Quantitative Model for Ordered Cdk Substrate Dephosphorylation during Mitotic Exit. in vitro In vitro phosphatase assay phosphatase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Bouchoux C., Uhlmann F. frank.uhlmann@cancer.org.uk Cell (0092-8674) 2011 Only protein-protein interactions imex curation bouchoux-2011-5 A Quantitative Model for Ordered Cdk Substrate Dephosphorylation during Mitotic Exit. in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Bouchoux C., Uhlmann F. frank.uhlmann@cancer.org.uk Cell (0092-8674) 2011 Only protein-protein interactions imex curation bouchoux-2011-4 A Quantitative Model for Ordered Cdk Substrate Dephosphorylation during Mitotic Exit. in vitro In vitro phosphatase assay phosphatase assay tag visualisation tag visualisation Bouchoux C., Uhlmann F. frank.uhlmann@cancer.org.uk Cell (0092-8674) 2011 Only protein-protein interactions imex curation cg22_yeast G2/mitotic-specific cyclin-2 CLB2 P9642.6 YPR119W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNPIENTENSQNTSSSRFLRNVQRLALNNVTNTTFQKSNANNPALTNFKSTLNSVKKEGSRIPQFTRESVSRSTAAQEEKRTLKENGIQLPKNNLLDDKENQDPSSQQFGALTSIKEGRAELPANISLQESSSAKEIIQHDPLKGVGSSTEVVHNSVENEKLHPARSQLQVRNTESETDSGKKRPISTIVEQELPKKFKVCDENGKEEYEWEDLDAEDVNDPFMVSEYVNDIFEYLHQLEVITLPKKEDLYQHRNIHQNRDILVNWLVKIHNKFGLLPETLYLAINIMDRFLGKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFASETDGACTEDEIKEGEKFILKTLKFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEISLVDFRFIGILPSLCAAAAMFMSRKMLGKGKWDGNLIHYSGGYTKEELAPVCHMIMDYLVSPIVHDEFHRKYQSRRFMKASIISVQWALKVRKNGYDIMTLHE B68FF888871022A0 fin1_yeast Filament protein FIN1 FIN1 YDR130C YD9302.05C Filaments in between nuclei protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNKSNRRSLRDIGNTIGRNNIPSDKDNVFVRLSMSPLRTTSQKEFLKPPMRISPNKTDGMKHSIQVTPRRIMSPECLKGYVSKETQSLDRPQFKNSNKNVKIQNSDHITNIIFPTSPTKLTFSNENKIGGDGSLTRIRARFKNGLMSPERIQQQQQQHILPSDAKSNTDLCSNTELKDAPFENDLPRAKLKGKNLLVELKKEEEDVGNGIESLTKSNTKLNSMLANEGKIHKASFQKSVKFKLPDNIVTEETVELKEIKDLLLQMLRRQREIESRLSNIELQLTEIPKHK FD4DB73A50F50172 ask1_yeast DASH complex subunit ASK1 YKL052C YKL306 ASK1 Outer kinetochore protein ASK1 Associated with spindles and kinetochores protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSASKEETLEKLDQEITVNLQKIDSNLSFCFHKITQDIIPHVATYSEICERIMDSTEWLGTMFQETGLVNLQANAAAPVGNAPVKSLVSNNVGIFPTSAEEASRQSQTDNGPNEADSAVHVNRDVHSMFNNDSIDDFHTANITSTGQILKLPDSSDEDTGSEAVPSREQTDLTGEGHGGADDEQDESTIQRQSRKRKISLLLQQQYGSSSSMVPSPIVPNKMRKQLAHEEHINNDGDNDDENSNNIESSPLKQGHHHPKGQADDNNEGPDEEESTKEVPKPGTIIHFSTNR sli15_yeast Inner centromere protein-related protein SLI15 YBR1206 YBR156C SLI15 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDWAIKAARKKTQRKPGSTRSIIETLDDLNNLTTDAHSEINQRLYESSEWLRNNVYMNTLKYEDKKMEESLISPENTHNKMDVEFPKMKGEYELSNSQNDAAKDVTKTPRNGLHNDKSITPKSLRRKEVTEGMNRFSIHDTNKSPVEPLNSVKVDANESEKSSPWSPYKVEKVLRESSKTSESPINTKRFDNQTWAAKEEMENEPILQALKKAESVKVKPPPNSGIARSQRRSNMFVPLPNKDPLIIQHIPPTKSSGSIPKVRTVKESPIAFKKKSTINSPAIRAVENSDTAGSTKASSVFDRLSSIPTKSFENKISRGNVGHKYSSSSIDLTGSPMKKVSQKFKSINSTDTDMQEALRDIFSVKNKITKNNSPKGKNSRKSSIPRFDKTSLKLTTHKKLAIIAEQKKKSKHSSDVHKTGSRPHSISPTKISVDSSSPSKEVKNYYQSPVRGYLRPTKASISPNKNKNLTTSQTPHRLKIKEKTLRKLSPNIADISKPESRKSKNYRLTNLQLLPPAEAERDDLKKKFDKRLSGIMRSQQEHHRRKQEKQKRMSHLEQDLKKQTSFSNDYKDIRLKESLAPFDNHVRDTINKNTAFSTDNILATINTVDHREIIGNVTPKIASVNDSLPEINTDSEDEASVTLAAWAKSPYLQEQLIRQQDINPQTIFGPIPPLHTDEIFPNPRLNRLKPRQIVPKRS 827AC2AB884BA7D1 orc6_yeast Origin recognition complex subunit 6 YHR118C ORC6 AAP1 Origin recognition complex 50 kDa subunit ACS-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHICAYIASQKMNEKHMPDLCYYIDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRSGRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFRKLGSMLQTTNILVTDDQYNIWKKRIEMDLALTEPL 22803C70378B7E85 cdc14_yeast Tyrosine-protein phosphatase CDC14 CDC14 OAF3 YFR028C protein protein yeast Saccharomyces cerevisiae Baker's yeast MRRSVYLDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLYRFAVIFHEILNDPENANKAVVFYSSASTRQRANAACMLCCYMILVQAWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLATKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSIVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWLYLHQNDFREWKYTTRISLKPSEAIGGLYPLISLEEYRLQKKKLKDDKRVAQNNIEGELRDLTMTPPSNGHGALSARNSSQPSTANNGSNSFKSSAVPQTSPGQPRKGQNGSNTIEDINNNRNPTSHANRKVVIESNNSDDESMQDTNGTSNHYPKVSRKKNDISSASSSRMEDNEPSATNINNAADDTILRQLLPKNRRVTSGRRTTSAAGGIRKISGSIKK 4EB3985DFA3FD823 4-nitrophenyl phosphate(2−) 4-nitrophenyl phosphate(2−) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) clb2-fin1 1244673 n/a 1244678 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 1244679 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 1244673 Figs. 4B, 5 ask1-clb2 1244673 n/a 1244678 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 1244680 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 1244673 Figs. 4B, 5 clb2-sli15 1244673 n/a 1244681 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) n/a 1244678 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast phosphorylation phosphorylation reaction phosphorylation false false false 1244673 Fig. 4B clb2-orc6 1244673 n/a 1244678 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 1244682 enzyme target enzyme target substrate substrate unspecified role unspecified role ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false 1244673 Figs. 4B, 5 ask1-clb2-1 1244674 n/a 1244678 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 1244680 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Supp. Fig. 2A clb2-fin1-1 1244674 n/a 1244679 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1244678 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast phosphorylation phosphorylation reaction phosphorylation false false false Supp. Fig. 2A clb2-orc6-1 1244674 n/a 1244678 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 1244682 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false Supp. Fig. 2A clb2-sli15-1 1244674 n/a 1244681 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1244678 enzyme enzyme unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast phosphorylation phosphorylation reaction phosphorylation false false false Supp. Fig. 2A cdc14-orc6 1244675 n/a 1244683 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1244682 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation false false false Fig. 6, &A, 7B cdc14-fin1 1244675 n/a 1244683 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1244679 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation false false false Fig. 6, 7A, 7B cdc14-sli15 1244675 n/a 1244683 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1244681 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation false false false Fig. 6, 7A, 7B ask1-cdc14 1244675 n/a 1244680 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1244683 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) dephosphorylation dephosphorylation reaction dephosphorylation false false false Fig. 6 cdc14-sli15 1244676 n/a 1244683 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1244681 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp. Fig. 4 Binding was stronger using phosphorylated substrates, although Cdc14 clearly interacted with Sli1 independently of phosphorylation. cdc14-orc6 1244676 n/a 1244683 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q00684:p.Cys283Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1244682 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp. Fig. 4B Binding was stronger using phosphorylated substrates, although Cdc14 clearly interacted with Orc6 independently of phosphorylation. cdc14-ask1 1244676 n/a 1244680 unspecified role unspecified role prey prey region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1244683 unspecified role unspecified role bait bait Q00684:p.Cys283Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp. Fig. 4B Binding was stronger using phosphorylated substrates, although Cdc14 clearly interacted with Ask1 independently of phosphorylation. cdc14-fin1 1244676 n/a 1244679 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1244683 unspecified role unspecified role bait bait Q00684:p.Cys283Ser mutation mutation certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp. Fig. 4B Binding was stronger using phosphorylated substrates, although Cdc14 clearly interacted with Fin1 independently of phosphorylation. 4_nitrophenyl_-cdc14 1244677 n/a 1244683 enzyme enzyme unspecified role unspecified role Q00684:p.Cys283His mutation mutation certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1244684 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) dephosphorylation dephosphorylation reaction dephosphorylation false false false Supp. Fig. 4A 4_nitropheny-cdc14-1 1244677 n/a 1244683 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q00684:p.Cys283His mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1244684 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) dephosphorylation dephosphorylation reaction dephosphorylation false false false Supp. Fig. 4A CDC14 Cys293His mutation was catalytically inactive