IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ yang-2011a-4 ncRNA- and Pc2 Methylation-Dependent Gene Relocation between Nuclear Structures Mediates Gene Activation Programs. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Yang L., Lin C., Liu W., Zhang J., Ohgi K.A., Grinstein J.D., Dorrestein P.C., Rosenfeld M.G. Reaction performed in the presence of [3H]-SAM. Data involving the use of Histone H3, H2A, H2B could not be curated as these could not be ascribed to single gene products. Source of SUMO1, SUMO2, SUMO3 could not be traced, sequence of RNA TUG1 and NEAT2 not given so interactions involving these molecules could not be curated. mrosenfeld@ucsd.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation yang-2011a-3 ncRNA- and Pc2 Methylation-Dependent Gene Relocation between Nuclear Structures Mediates Gene Activation Programs. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang L., Lin C., Liu W., Zhang J., Ohgi K.A., Grinstein J.D., Dorrestein P.C., Rosenfeld M.G. Reaction performed in the presence of [3H]-SAM. Data involving the use of Histone H3, H2A, H2B could not be curated as these could not be ascribed to single gene products. Source of SUMO1, SUMO2, SUMO3 could not be traced, sequence of RNA TUG1 and NEAT2 not given so interactions involving these molecules could not be curated. mrosenfeld@ucsd.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation yang-2011a-1 ncRNA- and Pc2 Methylation-Dependent Gene Relocation between Nuclear Structures Mediates Gene Activation Programs. in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yang L., Lin C., Liu W., Zhang J., Ohgi K.A., Grinstein J.D., Dorrestein P.C., Rosenfeld M.G. Reaction performed in the presence of [3H]-SAM. Data involving the use of Histone H3, H2A, H2B could not be curated as these could not be ascribed to single gene products. Source of SUMO1, SUMO2, SUMO3 could not be traced, sequence of RNA TUG1 and NEAT2 not given so interactions involving these molecules could not be curated. mrosenfeld@ucsd.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation yang-2011a-2 ncRNA- and Pc2 Methylation-Dependent Gene Relocation between Nuclear Structures Mediates Gene Activation Programs. in vitro In vitro demethylase assay demethylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yang L., Lin C., Liu W., Zhang J., Ohgi K.A., Grinstein J.D., Dorrestein P.C., Rosenfeld M.G. Reaction performed in the presence of [3H]-SAM. Data involving the use of Histone H3, H2A, H2B could not be curated as these could not be ascribed to single gene products. Source of SUMO1, SUMO2, SUMO3 could not be traced, sequence of RNA TUG1 and NEAT2 not given so interactions involving these molecules could not be curated. mrosenfeld@ucsd.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation cbx4_human E3 SUMO-protein ligase CBX4 Chromobox protein homolog 4 Polycomb 2 homolog CBX4 protein protein human Homo sapiens Human MELPAVGEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDLGAQGKGQGHQYELNSKKHHQYQPHSKERAGKPPPPGKSGKYYYQLNSKKHHPYQPDPKMYDLQYQGGHKEAPSPTCPDLGAKSHPPDKWAQGAGAKGYLGAVKPLAGAAGAPGKGSEKGPPNGMMPAPKEAVTGNGIGGKMKIVKNKNKNGRIVIVMSKYMENGMQAVKIKSGEVAEGEARSPSHKKRAADERHPPADRTFKKAAGAEEKKVEAPPKRREEEVSGVSDPQPQDAGSRKLSPTKEAFGEQPLQLTTKPDLLAWDPARNTHPPSHHPHPHPHHHHHHHHHHHHAVGLNLSHVRKRCLSETHGEREPCKKRLTARSISTPTCLGGSPAAERPADLPPAAALPQPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV hxa2_human_gene Homeobox protein Hox-A2 gene gene gene human Homo sapiens Human ccne1_human_gene Human Cyclin E1 gene gene gene human Homo sapiens Human mpip1_human_gene M-phase inducer phosphatase 1 gene gene gene human Homo sapiens Human cdc6_human_gene Cell division control protein 6 homolog gene gene gene human Homo sapiens Human ccnb1_human_gene G2/mitotic-specific cyclin-B1 gene gene gene human Homo sapiens Human dyr_human_gene Dihydrofolate reductase gene gene gene human Homo sapiens Human mcm3_human_gene gene gene human Homo sapiens Human msh2_human_gene DNA mismatch repair protein Msh2 gene gene gene human Homo sapiens Human orc1_human_gene Origin recognition complex subunit 1 gene gene gene human Homo sapiens Human pcna_human_gene Proliferating cell nuclear antigen gene gene gene human Homo sapiens Human dpola_human_gene DNA polymerase alpha catalytic subunit gene gene gene human Homo sapiens Human rbl1_human_gene RBL1 protein gene gene gene human Homo sapiens Human kdm4c_human Lysine-specific demethylase 4C KDM4C GASC1 JHDM3C JMJD2C KIAA0780 Gene amplified in squamous cell carcinoma 1 protein JmjC domain-containing histone demethylation protein 3C Jumonji domain-containing protein 2C [histone H3]-trimethyl-L-lysine(9) demethylase 4C protein protein human Homo sapiens Human MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQCYDDIDNLLIPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKYCTPRYLDYEDLERKYWKNLTFVAPIYGADINGSIYDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKYGIPFDKITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATVRWIDYGKVAKLCTCRKDMVKISMDIFVRKFQPDRYQLWKQGKDIYTIDHTKPTPASTPEVKAWLQRRRKVRKASRSFQCARSTSKRPKADEEEEVSDEVDGAEVPNPDSVTDDLKVSEKSEAAVKLRNTEASSEEESSASRMQVEQNLSDHIKLSGNSCLSTSVTEDIKTEDDKAYAYRSVPSISSEADDSIPLSSGYEKPEKSDPSELSWPKSPESCSSVAESNGVLTEGEESDVESHGNGLEPGEIPAVPSGERNSFKVPSIAEGENKTSKSWRHPLSRPPARSPMTLVKQQAPSDEELPEVLSIEEEVEETESWAKPLIHLWQTKSPNFAAEQEYNATVARMKPHCAICTLLMPYHKPDSSNEENDARWETKLDEVVTSEGKTKPLIPEMCFIYSEENIEYSPPNAFLEEDGTSLLISCAKCCVRVHASCYGIPSHEICDGWLCARCKRNAWTAECCLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQRLKLKCIFCRHRVKRVSGACIQCSYGRCPASFHVTCAHAAGVLMEPDDWPYVVNITCFRHKVNPNVKSKACEKVISVGQTVITKHRNTRYYSCRVMAVTSQTFYEVMFDDGSFSRDTFPEDIVSRDCLKLGPPAEGEVVQVKWPDGKLYGAKYFGSNIAHMYQVEFEDGSQIAMKREDIYTLDEELPKRVKARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQKRQ cda7l_human Cell division cycle-associated 7-like protein CDCA7L HR1 JPO2 R1 Protein JPO2 Transcription factor RAM2 protein protein human Homo sapiens Human MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDVRFHSKYFTEELRRIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSIGLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESEDDSRDESQESSDALLKRTMNIKENKAMLAQLLAELNSMPDFFPVRTPTSASRKKTVRRAFSEGQITRRMNPTRSARPPEKFALENFTVSAAKFAEEFYSFRRRKTIGGKCREYRRRHRISSFRPVEDITEEDLENVAITVRDKIYDKVLGNTCHQCRQKTIDTKTVCRNQGCCGVRGQFCGPCLRNRYGEDVRSALLDPDWVCPPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVEDN 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN bmi1_human Polycomb complex protein BMI-1 BMI1 PCGF4 RNF51 Polycomb group RING finger protein 4 RING finger protein 51 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG phc1_human Polyhomeotic-like protein 1 Early development regulatory protein 1 PHC1 EDR1 PH1 protein protein human Homo sapiens Human METESEQNSNSTNGSSSSGGSSRPQIAQMSLYERQAVQALQALQRQPNAAQYFHQFMLQQQLSNAQLHSLAAVQQATIAASRQASSPNTSTTQQQTTTTQASINLATTSAAQLISRSQSVSSPSATTLTQSVLLGNTTSPPLNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAVRNQQASAQGPQMQGSTQKAIPPGASPVSSLSQASSQALAVAQASSGATNQSLNLSQAGGGSGNSIPGSMGPGGGGQAHGGLGQLPSSGMGGGSCPRKGTGVVQPLPAAQTVTVSQGSQTEAESAAAKKAEADGSGQQNVGMNLTRTATPAPSQTLISSATYTQIQPHSLIQQQQQIHLQQKQVVIQQQIAIHHQQQFQHRQSQLLHTATHLQLAQQQQQQQQQQQQQQQPQATTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSPLSLPPDAAPKPPIPIQSKPPVAPIKPPQLGAAKMSAAQQPPPHIPVQVVGTRQPGTAQAQALGLAQLAAAVPTSRGMPGTVQSGQAHLASSPPSSQAPGALQECPPTLAPGMTLAPVQGTAHVVKGGATTSSPVVAQVPAAFYMQSVHLPGKPQTLAVKRKADSEEERDDVSTLGSMLPAKASPVAESPKVMDEKSSLGEKAESVANVNANTPSSELVALTPAPSVPPPTLAMVSRQMGDSKPPQAIVKPQILTHIIEGFVIQEGAEPFPVGCSQLLKESEKPLQTGLPTGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRKKMKEFQEANYARVRRRGPRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRWSVEEVYEFIASLQGCQEIAEEFRSQEIDGQALLLLKEEHLMSAMNIKLGPALKICAKINVLKET ring1_human E3 ubiquitin-protein ligase RING1 RING finger protein 1 Polycomb complex protein RING1 RING1 RNF1 Really interesting new gene 1 protein RING-type E3 ubiquitin transferase RING1 protein protein human Homo sapiens Human MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK suv91_human Histone-lysine N-methyltransferase SUV39H1 SUV39H1 SUV39H KMT1A Suppressor of variegation 3-9 homolog 1 Position-effect variegation 3-9 homolog Histone H3-K9 methyltransferase 1 Lysine N-methyltransferase 1A protein protein human Homo sapiens Human MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVGCECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF cbx4-hxa2 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243562 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D cbx4-ccne1 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243563 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-mpip1 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243564 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-cdc6 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243565 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-ccnb1 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243566 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-dyr 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243567 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-mcm3 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243568 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-msh2 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243569 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-orc1 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243570 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-pcna 1243557 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243571 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-dpola 1243557 n/a 1243572 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 2D Serum cbx4-rbl1 1243557 n/a 1243573 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false association association false false false Fig. 2D Serum cbx4-ccne1-1 1243557 n/a 1243563 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243561 unspecified role unspecified role bait bait association association false false false Fig. 2D Serum cbx4-mpip1-1 1243557 n/a 1243564 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243561 unspecified role unspecified role bait bait association association false false false Fig. 2D Serum cbx4-cdc6-1 1243557 n/a 1243561 unspecified role unspecified role bait bait n/a 1243565 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-ccnb1-1 1243557 n/a 1243561 unspecified role unspecified role bait bait n/a 1243566 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-dyr-1 1243557 n/a 1243561 unspecified role unspecified role bait bait n/a 1243567 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-mcm3-1 1243557 n/a 1243561 unspecified role unspecified role bait bait n/a 1243568 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-msh2-1 1243557 n/a 1243569 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243561 unspecified role unspecified role bait bait association association false false false Fig. 2D Serum cbx4-orc1-1 1243557 n/a 1243561 unspecified role unspecified role bait bait n/a 1243570 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-pcna-1 1243557 n/a 1243561 unspecified role unspecified role bait bait n/a 1243571 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-dpola-1 1243557 n/a 1243561 unspecified role unspecified role bait bait n/a 1243572 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum cbx4-kdm4c-1 1243557 n/a 1243574 unspecified role unspecified role bait bait n/a 1243573 unspecified role unspecified role prey prey association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-rbl1 1243557 n/a 1243573 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-ccne1 1243557 n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243563 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-ccne1-1 1243557 n/a 1243574 unspecified role unspecified role bait bait n/a 1243563 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-mpip1 1243557 n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243564 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-cdc6 1243557 n/a 1243565 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2D Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-ccnb1 1243557 n/a 1243566 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-dyr 1243557 n/a 1243567 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-mcm3 1243557 n/a 1243568 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-msh2 1243557 n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243569 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-orc1 1243557 n/a 1243570 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-pcna 1243557 n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243571 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters kdm4c-dpola 1243557 n/a 1243574 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243572 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 2E, F Serum Serum stimulation resulted in increased recruitment of KDM4C on target gene promoters which correlated with a decreased CBX4 Lys-191me2 level .The KDM4C-His190Gly/Glu192Ala mutant largely inhibited CBX2 Lys-191me2 demethylation, despite being equally recruited on the same set of promoters cdca7l-ccne1 1243557 n/a 1243575 unspecified role unspecified role bait bait n/a 1243563 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C Serum cdca7l-cdc6 1243557 n/a 1243565 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243575 unspecified role unspecified role bait bait association association false false false Fig. 7C Serum cdca7l-ccnb1 1243557 n/a 1243575 unspecified role unspecified role bait bait n/a 1243566 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C Serum cdca7l-dyr 1243557 n/a 1243567 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243575 unspecified role unspecified role bait bait association association false false false Fig. 2D Serum cdca7l-mcm3 1243557 n/a 1243575 unspecified role unspecified role bait bait n/a 1243568 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C Serum cdca7l-msh2 1243557 n/a 1243569 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1243575 unspecified role unspecified role bait bait association association false false false Fig. 7C Serum cdca7l-orc1 1243557 n/a 1243575 unspecified role unspecified role bait bait n/a 1243570 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C Serum cdca7l-pcna 1243557 n/a 1243575 unspecified role unspecified role bait bait n/a 1243571 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C Serum cdca7l-pcna-1 1243557 n/a 1243575 unspecified role unspecified role bait bait n/a 1243571 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C Serum cdca7l-dpola 1243557 n/a 1243575 unspecified role unspecified role bait bait n/a 1243572 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C Serum cdca7l-rbl1 1243557 n/a 1243575 unspecified role unspecified role bait bait n/a 1243573 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 7C Serum cbx4-ywhab 1243558 n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain false n/a 1243576 unspecified role unspecified role prey prey physical association physical association false false false Fig. 4G cbx4-bmi1-1 1243558 n/a 1243576 unspecified role unspecified role prey prey lys-191 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain false n/a 1243561 unspecified role unspecified role bait bait lys-191 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false n/a 1243577 unspecified role unspecified role prey prey n/a 1243578 unspecified role unspecified role prey prey n/a 1243579 unspecified role unspecified role prey prey association association false false false Fig. 4G cbx4-suv39h1 1243559 n/a 1243580 enzyme enzyme unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O43463:p.His320Arg mutation mutation certain certain sequence position certain certain certain sequence position certain false O43463:p.His324Leu mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1243561 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O00257:p.Lys191Arg mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) methylation methylation reaction methylation false false false Fig. 1A, B, D A Suv39h1 hyperactive mutant (H320R) further enhanced the methylation of CBX4, whereas an enzymatically inactive Suv39h1 mutant (H324L) failed to use Pc2 as substrate. A Lys191Arg mutation of CBX4 prevented phosphorylation of CBX4. cbx4-kdm4c 1243560 n/a 1243561 enzyme target enzyme target substrate substrate unspecified role unspecified role lys-191 melys methylated lysine MeLys certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1243574 enzyme enzyme unspecified role unspecified role Q9H3R0:p.[His190Gly;Glu192Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false demethylation demethylation reaction demethylation false false false Fig. 2A, 2B The enzymatically inactive KDM4C-His190Gly/Glu192Aala mutant failed to demethylate CBX4 Lys191me2