MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint nguyen-2011-1 Analysis of subunit assembly and function of the Saccharomyces cerevisiae RNase H2 complex. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Nguyen TA., Tak YS., Lee CH., Kang YH., Cho IT., Seo YS. FEBS J. (1742-464X) 2011 Only protein-protein interactions imex curation rnh2a_yeast Ribonuclease H2 subunit A YNL072W RNH35 RNase H(201) RNase H(35) N2369 RNH201 Ribonuclease HI subunit A Ribonuclease HI large subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MVPPTVEASLESPYTKSYFSPVPSALLEQNDSPIIMGIDEAGRGPVLGPMVYAVAYSTQKYQDETIIPNYEFDDSKKLTDPIRRMLFSKIYQDNEELTQIGYATTCITPLDISRGMSKFPPTRNYNLNEQAHDVTMALIDGVIKQNVKLSHVYVDTVGPPASYQKKLEQRFPGVKFTVAKKADSLYCMVSVASVVAKVTRDILVESLKRDPDEILGSGYPSDPKTVAWLKRNQTSLMGWPANMVRFSWQTCQTLLDDASKNSIPIKWEEQYMDSRKNAAQKTKQLQLQMVAKPVRRKRLRTLDNWYR rnh2c_yeast Ribonuclease H2 subunit C RNase H(203) YLR154C RNH203 Ribonuclease HI subunit C protein protein yeast Saccharomyces cerevisiae Baker's yeast MTKDAVNLDAYTVSFMPFYTEYQGPTEEFKDYKFEDTIYFRGKELKREKSATPSSSDNTTSNTFSNGAILSGNTITGKIVSVNNYEREGTDRNELARLQELISLIDVINQ 87A110F6A1754426 rnh2b_yeast Ribonuclease H2 subunit B RNH202 Ribonuclease HI subunit B RNase H(202) YDR279W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTVSNIGGEERLIILPDDYETSKTINTFTLPPPSNITSKPRIELFENINGKLYEIRSFQFGKGPSYSHEEDLANDKYHYTKENHPIKSTFIVNTSDPTDGYVFNSSKIHFCSLYDIAFSLIGFYYRNSVSADEQDYSNSSDTGENQKSNSKTNEKFLTVRDYHDFLTDNHDKNWENISLSRLKSGLAKVSETIEEAGDVYYKITSAMITQFLLGKVSKIVENFPPSIPTLKNAPTEIKQCYKVVMATNLLVSLIPRAAYHNLLTFSPTMDSGCLNPDIKASFIELENYETTNELQNAERELLMKSAMNVGLNSNGRVSLPVKKVTKKIVQNKKPKVAIGKGAIDGFFKRK 68578B3018579583 rnh201-rnh203 1188520 rnh2a_yeast RNH201 1188521 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rnh2c_yeast RNH203 1188522 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1c mint rnh202-rnh203 1188520 rnh2c_yeast RNH203 1188522 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rnh2b_yeast RNH202 1188523 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f1d mint rnh202-rnh201 1188520 rnh2a_yeast RNH201 1188521 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rnh2b_yeast RNH202 1188523 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait partially purified partially purified tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3c mint