IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fong-2011-7 A DNA repair complex functions as an oct4/sox2 coactivator in embryonic stem cells. mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Fong Y.W., Inouye C., Yamaguchi T., Cattoglio C., Grubisic I., Tjian R. Nuclear extracts were prepared from NT2 cells, precipitated with ammonium sulfate and resuspended. Soluble fraction was applied to a P11-phosphocellulose column, washed and eluted at 1.0 M KCl (P1M). This P1M fraction was adjusted to 0.05% NP-40 and 10 mM imidazole, applied to a Ni-NTA resin The final Ni-FT fraction was dialyzed and applied to a Poros 20 HQ column and developed with a linear gradient from 0.52 M to 1.0 M KCl. Transcriptionally active fractions were pooled, dialyzed t applied to a Poros 20 HS column, and subjected to a linear gradient from 0.42 M to 1.0 M KCl. Active HS fractions were pooled and applied directly to hydroxyapatite (HAP) type II ceramic resin, and subjected to a linear gradient from 0.19 M to 0.5 M KPi. Active HAP fractions were pooled and separated on a Superose 6 XK 16/70 gel filtration column . Active Superose 6 fractions with an apparent molecular mass of 500-700kDa were pooled and supplemented with 0.25 mg/ml insulin. Pooled fractions were applied to a Poros 20 HE column, and developed with a linear gradient from 0.36 M to 0.86 M KCl. Active HE fractions were supplemented with 0.3 mg/ml insulin, dialyzed and applied to a Mono S PC 1.6/5 column and developed with a linear gradient from 0.2 M to 0.7 M KCl. jmlim@berkeley.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation fong-2011-4 A DNA repair complex functions as an oct4/sox2 coactivator in embryonic stem cells. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fong Y.W., Inouye C., Yamaguchi T., Cattoglio C., Grubisic I., Tjian R. Nuclear extracts were prepared from NT2 cells, precipitated with ammonium sulfate and resuspended. Soluble fraction was applied to a P11-phosphocellulose column, washed and eluted at 1.0 M KCl (P1M). This P1M fraction was adjusted to 0.05% NP-40 and 10 mM imidazole, applied to a Ni-NTA resin The final Ni-FT fraction was dialyzed and applied to a Poros 20 HQ column and developed with a linear gradient from 0.52 M to 1.0 M KCl. Transcriptionally active fractions were pooled, dialyzed t applied to a Poros 20 HS column, and subjected to a linear gradient from 0.42 M to 1.0 M KCl. Active HS fractions were pooled and applied directly to hydroxyapatite (HAP) type II ceramic resin, and subjected to a linear gradient from 0.19 M to 0.5 M KPi. Active HAP fractions were pooled and separated on a Superose 6 XK 16/70 gel filtration column . Active Superose 6 fractions with an apparent molecular mass of 500-700kDa were pooled and supplemented with 0.25 mg/ml insulin. Pooled fractions were applied to a Poros 20 HE column, and developed with a linear gradient from 0.36 M to 0.86 M KCl. Active HE fractions were supplemented with 0.3 mg/ml insulin, dialyzed and applied to a Mono S PC 1.6/5 column and developed with a linear gradient from 0.2 M to 0.7 M KCl. jmlim@berkeley.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation fong-2011-5 A DNA repair complex functions as an oct4/sox2 coactivator in embryonic stem cells. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong Y.W., Inouye C., Yamaguchi T., Cattoglio C., Grubisic I., Tjian R. Nuclear extracts were prepared from NT2 cells, precipitated with ammonium sulfate and resuspended. Soluble fraction was applied to a P11-phosphocellulose column, washed and eluted at 1.0 M KCl (P1M). This P1M fraction was adjusted to 0.05% NP-40 and 10 mM imidazole, applied to a Ni-NTA resin The final Ni-FT fraction was dialyzed and applied to a Poros 20 HQ column and developed with a linear gradient from 0.52 M to 1.0 M KCl. Transcriptionally active fractions were pooled, dialyzed t applied to a Poros 20 HS column, and subjected to a linear gradient from 0.42 M to 1.0 M KCl. Active HS fractions were pooled and applied directly to hydroxyapatite (HAP) type II ceramic resin, and subjected to a linear gradient from 0.19 M to 0.5 M KPi. Active HAP fractions were pooled and separated on a Superose 6 XK 16/70 gel filtration column . Active Superose 6 fractions with an apparent molecular mass of 500-700kDa were pooled and supplemented with 0.25 mg/ml insulin. Pooled fractions were applied to a Poros 20 HE column, and developed with a linear gradient from 0.36 M to 0.86 M KCl. Active HE fractions were supplemented with 0.3 mg/ml insulin, dialyzed and applied to a Mono S PC 1.6/5 column and developed with a linear gradient from 0.2 M to 0.7 M KCl. jmlim@berkeley.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation fong-2011-1 A DNA repair complex functions as an oct4/sox2 coactivator in embryonic stem cells. human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). chromatography chromatography technology column chromatography chromatography sequence tag sequence tag identification sequence tag Fong Y.W., Inouye C., Yamaguchi T., Cattoglio C., Grubisic I., Tjian R. Nuclear extracts were prepared from NT2 cells, precipitated with ammonium sulfate and resuspended. Soluble fraction was applied to a P11-phosphocellulose column, washed and eluted at 1.0 M KCl (P1M). This P1M fraction was adjusted to 0.05% NP-40 and 10 mM imidazole, applied to a Ni-NTA resin The final Ni-FT fraction was dialyzed and applied to a Poros 20 HQ column and developed with a linear gradient from 0.52 M to 1.0 M KCl. Transcriptionally active fractions were pooled, dialyzed t applied to a Poros 20 HS column, and subjected to a linear gradient from 0.42 M to 1.0 M KCl. Active HS fractions were pooled and applied directly to hydroxyapatite (HAP) type II ceramic resin, and subjected to a linear gradient from 0.19 M to 0.5 M KPi. Active HAP fractions were pooled and separated on a Superose 6 XK 16/70 gel filtration column . Active Superose 6 fractions with an apparent molecular mass of 500-700kDa were pooled and supplemented with 0.25 mg/ml insulin. Pooled fractions were applied to a Poros 20 HE column, and developed with a linear gradient from 0.36 M to 0.86 M KCl. Active HE fractions were supplemented with 0.3 mg/ml insulin, dialyzed and applied to a Mono S PC 1.6/5 column and developed with a linear gradient from 0.2 M to 0.7 M KCl. jmlim@berkeley.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation fong-2011-2 A DNA repair complex functions as an oct4/sox2 coactivator in embryonic stem cells. human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). chromatography chromatography technology column chromatography chromatography western blot western blot Immuno blot Immuno blot Fong Y.W., Inouye C., Yamaguchi T., Cattoglio C., Grubisic I., Tjian R. Nuclear extracts were prepared from NT2 cells, precipitated with ammonium sulfate and resuspended. Soluble fraction was applied to a P11-phosphocellulose column, washed and eluted at 1.0 M KCl (P1M). This P1M fraction was adjusted to 0.05% NP-40 and 10 mM imidazole, applied to a Ni-NTA resin The final Ni-FT fraction was dialyzed and applied to a Poros 20 HQ column and developed with a linear gradient from 0.52 M to 1.0 M KCl. Transcriptionally active fractions were pooled, dialyzed t applied to a Poros 20 HS column, and subjected to a linear gradient from 0.42 M to 1.0 M KCl. Active HS fractions were pooled and applied directly to hydroxyapatite (HAP) type II ceramic resin, and subjected to a linear gradient from 0.19 M to 0.5 M KPi. Active HAP fractions were pooled and separated on a Superose 6 XK 16/70 gel filtration column . Active Superose 6 fractions with an apparent molecular mass of 500-700kDa were pooled and supplemented with 0.25 mg/ml insulin. Pooled fractions were applied to a Poros 20 HE column, and developed with a linear gradient from 0.36 M to 0.86 M KCl. Active HE fractions were supplemented with 0.3 mg/ml insulin, dialyzed and applied to a Mono S PC 1.6/5 column and developed with a linear gradient from 0.2 M to 0.7 M KCl. jmlim@berkeley.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation fong-2011-3 A DNA repair complex functions as an oct4/sox2 coactivator in embryonic stem cells. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight silver stain molecular weight estimation by silver staining weight silver stain Fong Y.W., Inouye C., Yamaguchi T., Cattoglio C., Grubisic I., Tjian R. Nuclear extracts were prepared from NT2 cells, precipitated with ammonium sulfate and resuspended. Soluble fraction was applied to a P11-phosphocellulose column, washed and eluted at 1.0 M KCl (P1M). This P1M fraction was adjusted to 0.05% NP-40 and 10 mM imidazole, applied to a Ni-NTA resin The final Ni-FT fraction was dialyzed and applied to a Poros 20 HQ column and developed with a linear gradient from 0.52 M to 1.0 M KCl. Transcriptionally active fractions were pooled, dialyzed t applied to a Poros 20 HS column, and subjected to a linear gradient from 0.42 M to 1.0 M KCl. Active HS fractions were pooled and applied directly to hydroxyapatite (HAP) type II ceramic resin, and subjected to a linear gradient from 0.19 M to 0.5 M KPi. Active HAP fractions were pooled and separated on a Superose 6 XK 16/70 gel filtration column . Active Superose 6 fractions with an apparent molecular mass of 500-700kDa were pooled and supplemented with 0.25 mg/ml insulin. Pooled fractions were applied to a Poros 20 HE column, and developed with a linear gradient from 0.36 M to 0.86 M KCl. Active HE fractions were supplemented with 0.3 mg/ml insulin, dialyzed and applied to a Mono S PC 1.6/5 column and developed with a linear gradient from 0.2 M to 0.7 M KCl. jmlim@berkeley.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation fong-2011-6 A DNA repair complex functions as an oct4/sox2 coactivator in embryonic stem cells. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Fong Y.W., Inouye C., Yamaguchi T., Cattoglio C., Grubisic I., Tjian R. Nuclear extracts were prepared from NT2 cells, precipitated with ammonium sulfate and resuspended. Soluble fraction was applied to a P11-phosphocellulose column, washed and eluted at 1.0 M KCl (P1M). This P1M fraction was adjusted to 0.05% NP-40 and 10 mM imidazole, applied to a Ni-NTA resin The final Ni-FT fraction was dialyzed and applied to a Poros 20 HQ column and developed with a linear gradient from 0.52 M to 1.0 M KCl. Transcriptionally active fractions were pooled, dialyzed t applied to a Poros 20 HS column, and subjected to a linear gradient from 0.42 M to 1.0 M KCl. Active HS fractions were pooled and applied directly to hydroxyapatite (HAP) type II ceramic resin, and subjected to a linear gradient from 0.19 M to 0.5 M KPi. Active HAP fractions were pooled and separated on a Superose 6 XK 16/70 gel filtration column . Active Superose 6 fractions with an apparent molecular mass of 500-700kDa were pooled and supplemented with 0.25 mg/ml insulin. Pooled fractions were applied to a Poros 20 HE column, and developed with a linear gradient from 0.36 M to 0.86 M KCl. Active HE fractions were supplemented with 0.3 mg/ml insulin, dialyzed and applied to a Mono S PC 1.6/5 column and developed with a linear gradient from 0.2 M to 0.7 M KCl. jmlim@berkeley.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation rd23b_mouse UV excision repair protein RAD23 homolog B XP-C repair-complementing complex 58 kDa protein Rad23b Mhr23b protein protein mouse Mus musculus Mouse MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALKEYKIDEKNFVVVMVTKPKAVTTAVPATTQPSSTPSPTAVSSSPAVAAAQAPAPTPALPPTSTPASTAPASTTASSEPAPAGATQPEKPAEKPAQTPVLTSPAPADSTPGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGSQGGGGGGGGGGGGGGGGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED nanog_mouse_gene gene gene mouse Mus musculus Mouse po5f1_mouse_gene POU domain, class 5, transcription factor 1 gene gene mouse Mus musculus Mouse sox2_mouse Transcription factor SOX-2 Sox2 Sox-2 protein protein mouse Mus musculus Mouse MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGGGLNQRMDSYAHMNGWSNGSYSMMQEQLGYPQHPGLNAHGAAQMQPMHRYVVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHYQSGPVPGTAKYGTLPLSHM po5f1_mouse POU domain, class 5, transcription factor 1 Pou5f1 Oct-3 Oct-4 Otf-3 Otf3 Octamer-binding transcription factor 3 NF-A3 Octamer-binding protein 3 Octamer-binding protein 4 protein protein mouse Mus musculus Mouse MAGHLASDFAFSPPPGGGDGSAGLEPGWVDPRTWLSFQGPPGGPGIGPGSEVLGISPCPPAYEFCGGMAYCGPQVGLGLVPQVGVETLQPEGQAGARVESNSEGTSSEPCADRPNAVKLEKVEPTPEESQDMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSLKNMCKLRPLLEKWVEEADNNENLQEICKSETLVQARKRKRTSIENRVRWSLETMFLKCPKPSLQQITHIANQLGLEKDVVRVWFCNRRQKGKRSSIEYSQREEYEATGTPFPGGAVSFPLPPGPHFGTPGYGSPHFTTLYSVPFPEGEAFPSVPVTALGSPMHSN xpc_mouse DNA repair protein complementing XP-C cells homolog Xpc Xeroderma pigmentosum group C-complementing protein homolog p125 protein protein mouse Mus musculus Mouse MAPKRTADGRRRKRGQKTEDNKVARHEESVADDFEDEKQKPRRKSSFPKVSQGKRKRGCSDPGDPTNGAAKKKVAKATAKSKNLKVLKEEALSDGDDFRDSPADCKKAKKHPKSKVVDQGTDEDDSEDDWEEVEELTEPVLDMGENSATSPSDMPVKAVEIEIETPQQAKERERSEKIKMEFETYLRRMMKRFNKEVQENMHKVHLLCLLASGFYRNSICRQPDLLAIGLSIIPIRFTKVPLQDRDAYYLSNLVKWFIGTFTVNADLSASEQDDLQTTLERRIAIYSARDNEELVHIFLLILRALQLLTRLVLSLQPIPLKSAVTKGRKSSKETSVEGPGGSSELSSNSPESHNKPTTSRRIKEEETLSEGRGKATARGKRGTGTAGSRQRRKPSCSEGEEAEQKVQGRPHARKRRVAAKVSYKEESESDGAGSGSDFEPSSGEGQHSSDEDCEPGPRKQKRASAPQRTKAGSKSASKTQRGSQCEPSSFPEASSSSSGCKRGKKVSSGAEEMADRKPAGVDQWLEVYCEPQAKWVCVDCVHGVVGQPVACYKYATKPMTYVVGIDSDGWVRDVTQRYDPAWMTATRKCRVDAEWWAETLRPYRSLLTEREKKEDQEFQAKHLDQPLPTSISTYKNHPLYALKRHLLKFQAIYPETAAVLGYCRGEAVYSRDCVHTLHSRDTWLKQARVVRLGEVPYKMVKGFSNRARKARLSEPQLHDHNDLGLYGHWQTEEYQPPIAVDGKVPRNEFGNVYLFLPSMMPVGCVQMTLPNLNRVARKLGIDCVQAITGFDFHGGYCHPVTDGYIVCEEFRDVLLAAWENEQAIIEKKEKEKKEKRALGNWKLLVRGLLIRERLKLRYGAKSEAAAPHAAGGGLSSDEEEGTSSQAEAARVLAASWPQNREDPEQKSEYTKMTRKRRAAEASHLFPFEKL cetn2_mouse Centrin-2 Cetn2 Calt Caltractin isoform 1 protein protein mouse Mus musculus Mouse MASNFKKTTMASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY cetn2_human Centrin-2 CETN2 CALT CEN2 Caltractin isoform 1 protein protein human Homo sapiens Human MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY xpc_human DNA repair protein complementing XP-C cells Xeroderma pigmentosum group C-complementing protein p125 XPC XPCC protein protein human Homo sapiens Human MARKRAAGGEPRGRELRSQKSKAKSKARREEEEEDAFEDEKPPKKSLLSKVSQGKRKRGCSHPGGSADGPAKKKVAKVTVKSENLKVIKDEALSDGDDLRDFPSDLKKAHHLKRGATMNEDSNEEEEESENDWEEVEELSEPVLGDVRESTAFSRSLLPVKPVEIEIETPEQAKTRERSEKIKLEFETYLRRAMKRFNKGVHEDTHKVHLLCLLANGFYRNNICSQPDLHAIGLSIIPARFTRVLPRDVDTYYLSNLVKWFIGTFTVNAELSASEQDNLQTTLERRFAIYSARDDEELVHIFLLILRALQLLTRLVLSLQPIPLKSATAKGKKPSKERLTADPGGSSETSSQVLENHTKPKTSKGTKQEETFAKGTCRPSAKGKRNKGGRKKRSKPSSSEEDEGPGDKQEKATQRRPHGRERRVASRVSYKEESGSDEAGSGSDFELSSGEASDPSDEDSEPGPPKQRKAPAPQRTKAGSKSASRTHRGSHRKDPSLPAASSSSSSSKRGKKMCSDGEKAEKRSIAGIDQWLEVFCEQEEKWVCVDCVHGVVGQPLTCYKYATKPMTYVVGIDSDGWVRDVTQRYDPVWMTVTRKCRVDAEWWAETLRPYQSPFMDREKKEDLEFQAKHMDQPLPTAIGLYKNHPLYALKRHLLKYEAIYPETAAILGYCRGEAVYSRDCVHTLHSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQL rd23b_human UV excision repair protein RAD23 homolog B XP-C repair-complementing complex 58 kDa protein RAD23B protein protein human Homo sapiens Human MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED rad23b-nanog 1215571 n/a 1215578 unspecified role unspecified role bait bait n/a 1215579 unspecified role unspecified role prey prey distal enhancer binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false transcription start site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 6A Analysis revealed that RAD23B occupancy sites coincide with those reported for Oct4 and Sox2 rad23b-po5f1 1215571 n/a 1215580 unspecified role unspecified role prey prey transcription start site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false distal enhancer binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1215578 unspecified role unspecified role bait bait association association false false false Fig. 6A Analysis revealed that RAD23B occupancy sites coincide with those reported for Oct4 and Sox2 sox2-nanog 1215571 n/a 1215579 unspecified role unspecified role prey prey distal enhancer binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false distal enhancer binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1215581 unspecified role unspecified role bait bait association association false false false Supp. Fig. 5A Analysis revealed that RAD23B occupancy sites coincide with those reported for Oct4 and Sox2 sox2-po5f1 1215571 n/a 1215580 unspecified role unspecified role prey prey distal enhancer binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1215581 unspecified role unspecified role bait bait association association false false false Fig. S5A Analysis revealed that RAD23B occupancy sites coincide with those reported for Oct4 and Sox2 rad23b-cetn2-2 1215572 n/a 1215582 unspecified role unspecified role prey prey n/a 1215583 unspecified role unspecified role prey prey n/a 1215578 unspecified role unspecified role bait bait n/a 1215581 unspecified role unspecified role prey prey n/a 1215584 unspecified role unspecified role prey prey association association false false false Fig. 4D rad23b-cetn2-5 1215572 n/a 1215578 unspecified role unspecified role prey prey n/a 1215583 unspecified role unspecified role prey prey n/a 1215584 unspecified role unspecified role prey prey n/a 1215582 unspecified role unspecified role bait bait association association false false false Fig. 4C rad23b-cetn2-3 1215573 n/a 1215585 unspecified role unspecified role prey prey n/a 1215586 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1215587 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig. 4E rad23b-cetn2-4 1215573 n/a 1215587 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1215586 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 4E, Supp Fig. 3C cetn2-rad23b 1215574 n/a 1215585 unspecified role unspecified role neutral component neutral component n/a 1215587 unspecified role unspecified role neutral component neutral component n/a 1215586 unspecified role unspecified role neutral component neutral component association association false false false Fig. 3A cetn2-rad23b-1 1215575 n/a 1215586 unspecified role unspecified role neutral component neutral component n/a 1215587 unspecified role unspecified role neutral component neutral component n/a 1215585 unspecified role unspecified role neutral component neutral component association association false false false Fig. 3B rad23b-cetn2 1215576 n/a 1215586 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1215587 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1215585 unspecified role unspecified role prey prey association association false false false Fig. 4A xpc-cetn2 1215577 n/a 1215585 unspecified role unspecified role prey prey n/a 1215586 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 4E