IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ rajagopala-2011-1 The protein interaction map of bacteriophage lambda. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined The author confidence score is the number of vector combinations in which the interaction has been observed. 2011-09-30: Peter Uetz,Proteros Biostructures, Am Klopferspitz 19, D - 82152 Martinsried, Germany. peter@uetz.us Only protein-protein interactions imex curation terl_lambd Terminase, large subunit A DNA-packaging protein A Large terminase protein gpA lambdap02 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MNISNSQVNRLRHFVRAGLRSLFRPEPQTAVEWADANYYLPKESAYQEGRWETLPFQRAIMNAMGSDYIREVNVVKSARVGYSKMLLGVYAYFIEHKQRNTLIWLPTDGDAENFMKTHVEPTIRDIPSLLALAPWYGKKHRDNTLTMKRFTNGRGFWCLGGKAAKNYREKSVDVAGYDELAAFDDDIEQEGSPTFLGDKRIEGSVWPKSIRGSTPKVRGTCQIERAASESPHFMRFHVACPHCGEEQYLKFGDKETPFGLKWTPDDPSSVFYLCEHNACVIRQQELDFTDARYICEKTGIWTRDGILWFSSSGEEIEPPDSVTFHIWTAYSPFTTWVQIVKDWMKTKGDTGKRKTFVNTTLGETWEAKIGERPDAEVMAERKEHYSAPVPDRVAYLTAGIDSQLDRYEMRVWGWGPGEESWLIDRQIIMGRHDDEQTLLRVDEAINKTYTRRNGAEMSISRICWDTGGIDPTIVYERSKKHGLFRVIPIKGASVYGKPVASMPRKRNKNGVYLTEIGTDTAKEQIYNRFTLTPEGDEPLPGAVHFPNNPDIFDLTEAQQLTAEEQVEKWVDGRKKILWDSKKRRNEALDCFVYALAALRISISRWQLDLSALLASLQEEDGAATNKKTLADYARALSGEDE vbet_lambd Recombination protein bet betA red-beta redB bet protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MSTALATLAGKLAERVGMDSVDPQELITTLRQTAFKGDASDAQFIALLIVANQYGLNPWTKEIYAFPDKQNGIVPVVGVDGWSRIINENQQFDGMDFEQDNESCTCRIYRKDRNHPICVTEWMDECRREPFKTREGREITGPWQSHPKRMLRHKAMIQCARLAFGFAGIYDKDEAERIVENTAYTAERQPERDITPVNDETMQEINTLLIALDKTWDDDLLPLCSQIFRRDIRASSELTQAEAVKALGFLKQKAAEQKVAA fi_lambd DNA-packaging protein FI Fi lambdap09 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MTKDELIARLRSLGEQLNRDVSLTGTKEELALRVAELKEELDDTDETAGQDTPLSRENVLTGHENEVGSAQPDTVILDTSELVTVVALVKLHTDALHATRDEPVAFVLPGTAFRVSAGVAAEMTERGLARMQ ninf_lambd Protein ninF ninF protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MIDQNRSYEQESVERALTCANCGQKLHVLEVHVCEHCCAELMSDPNSSMHEEEDDG ters_lambd Terminase small subunit Nu1 DNA-packaging protein Nu1 Gene product Nu1 lambdap01 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAAVIKWYAERDAEIENEKLRREVEELRQASEADLQPGTIEYERHRLTRAQADAQELKNARDSAEVVETAFCTFVLSRIAGEIASILDGLPLSVQRRFPELENRHVDFLKRDIIKAMNKAAALDELIPGLLSEYIEQSG sieb_lambd Superinfection exclusion protein B sieB git protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MMSIEMDPLVILGRVFSNEPLERTMYMIVIWVGLLLLSPDNWPEYVNERIGIPHVWHVFVFALAFSLAINVHRLSAIASARYKRFKLRKRIKMQNDKVRSVIQNLTEEQSMVLCAALNEGRKYVVTSKQFPYISELIELGVLNKTFSRWNGKHILFPIEDIYWTELVASYDPYNIEIKPRPISK tube_lambd Tail tube protein V Gene product V Major tail protein V lambdap13 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MPVPNPTMPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTAESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAEDRSTVTAATGMTVTPASTSVVKGQSTTLTVAFQPEGVTDKSFRAVSADKTKATVSVSGMTITVNGVAAGKVNIPVVSGNGEFAAVAEITVTAS rpc1_lambd Repressor protein cI cI lambdap88 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEYPVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSVVGKVIASQWPEETFG vkil_lambd Protein kil kil protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MPLQGGLLLAALPNLYLNESPVNYVTDGNALSTYLISQESQRMDQTLMAIQTKFTIATFIGDEKMFREAVDAYKKWILILKLRSSKSIH rpc2_lambd Transcriptional activator II cII lambdap59 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MVRANKRNEALRIESALLNKIAMLGTEKTAEAVGVDKSQISRWKRDWIPKFSMLLAVLEWGVVDDDMARLARQVAAILTNKKRPAATERSEQIQMEF scaf_lambd Capsid assembly protease C C NU3 Gene product C Minor capsid protein C lambdap05 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MTAELRNLPHIASMAFNEPLMLEPAYARVFFCALAGQLGISSLTDAVSGDSLTAQEALATLALSGDDDGPRQARSYQVMNGIAVLPVSGTLVSRTRALQPYSGMTGYNGIIARLQQAASDPMVDGILLDMDTPGGMVAGAFDCADIIARVRDIKPVWALANDMNCSAGQLLASAASRRLVTQTARTGSIGVMMAHSNYGAALEKQGVEITLIYSGSHKVDGNPYSHLPDDVRETLQSRMDATRQMFAQKVSAYTGLSVQVVLDTEAAVYSGQEAIDAGLADELVNSTDAITVMRDALDARKSRLSGGRMTKETQSTTVSATASQADVTDVVPATEGENASAAQPDVNAQITAAVAAENSRIMGILNCEEAHGREEQARVLAETPGMTVKTARRILAAAPQSAQARSDTALDRLMQGAPAPLAAGNPASDAVNDLLNTPV c6zcx5_lambd protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MNKEQSADDPSVDLIRVKNMLNSTISMSYPDVVIACIEHKVSLEAFRAIEAALVKHDNNMKDYSLVVD deco_lambd Capsid decoration protein D Major capsid protein D Auxiliary protein D Gene product D lambdap07 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MTSKETFTHYQPQGNSDPAHTATAPGGLSAKAPAMTPLMLDTSSRKLVAWDGTTDGAAVGILAVAADQTSTTLTFYKSGTFRYEDVLWPEAASDETKKRTAFAGTAISIV capsd_lambd Major capsid protein E Gene product E Major head protein lambdap08 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MSMYTTAQLLAANEQKFKFDPLFLRLFFRESYPFTTEKVYLSQIPGLVNMALYVSPIVSGEVIRSRGGSTSEFTPGYVKPKHEVNPQMTLRRLPDEDPQNLADPAYRRRRIIMQNMRDEELAIAQVEEMQAVSAVLKGKYTMTGEAFDPVEVDMGRSEENNITQSGGTEWSKRDKSTYDPTDDIEAYALNASGVVNIIVFDPKGWALFRSFKAVKEKLDTRRGSNSELETAVKDLGKAVSYKGMYGDVAIVVYSGQYVENGVKKNFLPDNTMVLGNTQARGLRTYGCIQDADAQREGINASARYPKNWVTTGDPAREFTMIQSAPLMLLADPDEFVSVQLA ea85_lambd Protein ea8.5 ea8.5 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MSINELESEQKDWALSMLCRSGVLSPCRHHEGVYVDEGIDIESAYKYSMKVYKSNEDKSPFCNVREMTDTVQNYYHEYGGNDTCPLCTKHIDD vint_lambd Integrase int protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MGRRRSHERRDLPPNLYIRNNGYYCYRDPRTGKEFGLGRDRRIAITEAIQANIELFSGHKHKPLTARINSDNSVTLHSWLDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTNHVAATRAAKSEVRRSRLTADEYLKIYQAAESSPCWLRLAMELAVVTGQRVGDLCEMKWSDIVDGYLYVEQSKTGVKIAIPTALHIDALGISMKETLDKCKEILGGETIIASTRREPLSSGTVSRYFMRARKASGLSFEGDPPTFHELRSLSARLYEKQISDKFAQHLLGHKSDTMASQYRDDRGREWDKIEIK tfa_lambd Tail fiber assembly protein tfa ORF-314 lambdap29 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MAFRMSEQPRTIKIYNLLAGTNEFIGEGDAYIPPHTGLPANSTDIAPPDIPAGFVAVFNSDEASWHLVEDHRGKTVYDVASGDALFISELGPLPENFTWLSPGGEYQKWNGTAWVKDTEAEKLFRIREAEETKKSLMQVASEHIAPLQDAADLEIATKEETSLLEAWKKYRVLLNRVDTSTAPDIEWPAVPVME fiber_lambd Tail fiber protein stf Gene product 27 lambdap27 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MAVKISGVLKDGTGKPVQNCTIQLKARRNSTTVVVNTVGSENPDEAGRYSMDVEYGQYSVILQVDGFPPSHAGTITVYEDSQPGTLNDFLCAMTEDDARPEVLRRLELMVEEVARNASVVAQSTADAKKSAGDASASAAQVAALVTDATDSARAASTSAGQAASSAQEASSGAEAASAKATEAEKSAAAAESSKNAAATSAGAAKTSETNAAASQQSAATSASTAATKASEAATSARDAVASKEAAKSSETNASSSAGRAASSATAAENSARAAKTSETNARSSETAAERSASAAADAKTAAAGSASTASTKATEAAGSAVSASQSKSAAEAAAIRAKNSAKRAEDIASAVALEDADTTRKGIVQLSSATNSTSETLAATPKAVKVVMDETNRKAPLDSPALTGTPTAPTALRGTNNTQIANTAFVLAAIADVIDASPDALNTLNELAAALGNDPDFATTMTNALAGKQPKNATLTALAGLSTAKNKLPYFAENDAASLTELTQVGRDILAKNSVADVLEYLGAGENSAFPAGAPIPWPSDIVPSGYVLMQGQAFDKSAYPKLAVAYPSGVLPDMRGWTIKGKPASGRAVLSQEQDGIKSHTHSASASGTDLGTKTTSSFDYGTKTTGSFDYGTKSTNNTGAHAHSLSGSTGAAGAHAHTSGLRMNSSGWSQYGTATITGSLSTVKGTSTQGIAYLSKTDSQGSHSHSLSGTAVSAGAHAHTVGIGAHQHPVVIGAHAHSFSIGSHGHTITVNAAGNAENTVKNIAFNYIVRLA regq_lambd Antitermination protein Q Q protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MRLESVAKFHSPKSPMMSDSPRATASDSLSGTDVMAAMGMAQSQAGFGMAAFCGKHELSQNDKQKAINYLMQFAHKVSGKYRGVAKLEGNTKAKVLQVLATFAYADYCRSAATPGARCRDCHGTGRAVDIAKTELWGRVVEKECGRCKGVGYSRMPASAAYRAVTMLIPNLTQPTWSRTVKPLYDALVVQCHKEESIADNILNAVTR vren_lambd Protein ren ren protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MTGKEAIIHYLGTHNSFCAPDVAALTGATVTSINQAAAKMARAGLLVIEGKVWRTVYYRFATREEREGKMSTNLVFKECRQSAAMKRVLAVYGVKR ninb_lambd Protein ninB ninB protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MKKLTFEIRSPAHQQNAIHAVQQILPDPTKPIVVTIQERNRSLDQNRKLWACLGDVSRQVEWHGRWLDAESWKCVFTAALKQQDVVPNLAGNGFVVIGQSTSRMRVGEFAELLELIQAFGTERGVKWSDEARLALEWKARWGDRAA g_lambd Tail assembly protein G G Gene product G Minor tail protein G Tail assembly chaperone lambdap14 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MFLKTESFEHNGVTVTLSELSALQRIEHLALMKRQAEQAESDSNRKFTVEDAIRTGAFLVAMSLWHNHPQKTQMPSMNEAVKQIEQEVLTTWPTEAISHAENVVYRLSGMYEFVVNNAPEQTEDAGPAEPVSAGKCSTVS tmp_lambd Tape measure protein H Minor tail protein H Gene product H lambdap16 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MAEPVGDLVVDLSLDAARFDEQMARVRRHFSGTESDAKKTAAVVEQSLSRQALAAQKAGISVGQYKAAMRMLPAQFTDVATQLAGGQSPWLILLQQGGQVKDSFGGMIPMFRGLAGAITLPMVGATSLAVATGALAYAWYQGNSTLSDFNKTLVLSGNQAGLTADRMLVLSRAGQAAGLTFNQTSESLSALVKAGVSGEAQIASISQSVARFSSASGVEVDKVAEAFGKLTTDPTSGLTAMARQFHNVSAEQIAYVAQLQRSGDEAGALQAANEAATKGFDDQTRRLKENMGTLETWADRTARAFKSMWDAVLDIGRPDTAQEMLIKAEAAYKKADDIWNLRKDDYFVNDEARARYWDDREKARLALEAARKKAEQQTQQDKNAQQQSDTEASRLKYTEEAQKAYERLQTPLEKYTARQEELNKALKDGKILQADYNTLMAAAKKDYEATLKKPKQSSVKVSAGDRQEDSAHAALLTLQAELRTLEKHAGANEKISQQRRDLWKAESQFAVLEEAAQRRQLSAQEKSLLAHKDETLEYKRQLAALGDKVTYQERLNALAQQADKFAQQQRAKRAAIDAKSRGLTDRQAEREATEQRLKEQYGDNPLALNNVMSEQKKTWAAEDQLRGNWMAGLKSGWSEWEESATDSMSQVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLKQAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAAKFHFATGGFTGTGGKYEPAGIVHRGEFVFTKEATSRIGVGNLYRLMRGYATGGYVGTPGSMADSRSQASGTFEQNNHVVINNDGTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLFSGGGR p03705-2 Antiholin S Lysis inhibitor S-107 Lysis protein S-105 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYNGGAFTKTVIDATMCAIIAWFIRDLLDFAGLSSNLAYITSVFIGYIGTDSIGSLIKRFAAKKAGVEDGRNQ Contains a N-formylmethionine at position 1. gt_lambd Tail assembly protein GT Gene product 15 T Gene product GT Minor tail protein GT lambdap15 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MFLKTESFEHNGVTVTLSELSALQRIEHLALMKRQAEQAESDSNRKFTVEDAIRTGAFLVAMSLWHNHPQKTQMPSMNEAVKQIEQEVLTTWPTEAISHAENVVYRLSGMYEFVVNNAPEQTEDAGPAEPVSAGKVFDGELSFALKLAREMGRPDWRAMLAGMSSTEYADWHRFYSTHYFHDVLLDMHFSGLTYTVLSLFFSDPDMHPLDFSLLNRREADEEPEDDVLMQKAAGLAGGVRFGPDGNEVIPASPDVADMTEDDVMLMTVSEGIAGGVRYG tipm_lambd Tail tip protein M M lambdap17 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MKTFRWKVKPGMDVASVPSVRKVRFGDGYSQRAPAGLNANLKTYSVTLSVPREEATVLESFLEEHGGWKSFLWTPPYEWRQIKVTCAKWSSRVSMLRVEFSAEFEQVVN c6zcu7_lambd protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MHFRVTGEWNGEPFNRVIEAENINDCYDHWMIWAQIAHADVTNIRIEELKEHQAA regn_lambd Antitermination protein N N Regulatory protein N lambdap49 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPKSRVESALNPIDLTVLAEYHKQIESNLQRIERKNQRTWYSKPGERGITCSGRQKIKGKSIPLI ea47_lambd Protein ea47 ea47 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MTKKPWERRLKDLSHLLKCCIDTYFDPELFRLNLNQFLQTARTVTFIIQKNKNQIIGYDIWYNNNVIEKWKNDPLMAWAKNSRNTIEKQGDLEMYSEAKATLISSYIEENDIEFITNESMLNIGIKKLVRLAQKKLPSYLTESSIIKSERRWVANTLKDYELLHALAIIYGRMYNCCNSLGIQINNPMGDDVISPTSFDSLFDEARRITYLKLKDYSISKLSFSMIQYDNKIIPEDIKERLKLVDKPKNITSTEELVDYTAKLAETTFLKDGYHIQTLIFYDKQFHPIDLINTTFEDQADKYIFWRYAADRAKITNAYGFIWISELWLRKASIYSNKPIHTMPIIDERLQVIGIDSNNNQKCISWKIVRENEEKKPTLEISTADSKHDEKPYFMRSVLKAIGGDVNTMNN tipl_lambd Tail tip protein L L lambdap18 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MQDIRQETLNECTRAEQSASVVLWEIDLTEVGGERYFFCNEQNEKGEPVTWQGRQYQPYPIQGSGFELNGKGTSTRPTLTVSNLYGMVTGMAEDMQSLVGGTVVRRKVYARFLDAVNFVNGNSYADPEQEVISRWRIEQCSELSAVSASFVLSTPTETDGAVFPGRIMLANTCTWTYRGDECGYSGPAVADEYDQPTSDITKDKCSKCLSGCKFRNNVGNFGGFLSINKLSQ nind_lambd Protein ninD ninD protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MMRCYRCGESKEDNRFRPNQPYWNRWCLRCERTPTGVLPLPQEKEDVWRDSDEVSPT rcro_lambd Regulatory protein cro cro lambdap57 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSNKKTTA tipk_lambd Tail tip assembly protein K K Tail assembly protein K Probable endopeptidase lambdap19 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MSPEDWLQAEMQGEIVALVHSHPGGLPWLSEADRRLQVQSDLPWWLVCRGTIHKFRCVPHLTGRRFEHGVTDCYTLFRDAYHLAGIEMPDFHREDDWWRNGQNLYLDNLEATGLYQVPLSAAQPGDVLLCCFGSSVPNHAAIYCGDGELLHHIPEQLSKRERYTDKWQRRTHSLWRHRAWRASAFTGIYNDLVAASTFV pp_lambd Serine/threonine-protein phosphatase protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA y64_lambd Putative uncharacterized protein ORF64 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MKRGGAYYRFRLVGHFDVSSGTPTIAGREVCKMQSRNSSQVIVRACITVSGFFISAQQVRALSR enlys_lambd Endolysin R Lysis protein Lysozyme Transglycosylase protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MVEINNQRKAFLDMLAWSEGTDNGRQKTRNHGYDVIVGGELFTDYSDHPRKLVTLNPKLKSTGAGRYQLLSRWWDAYRKQLGLKDFSPKSQDAVALQQIKERGALPMIDRGDIRQAIDRCSNIWASLPGAGYGQFEHKADSLIAKFKEAGGTVREIDV compl_lambd Tail completion protein Z Z Tail terminator protein lambdap11 Gene product Z Minor tail protein Z protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MAIKGLEQAVENLSRISKTAVPGAAAMAINRVASSAISQSASQVARETKVRRKLVKERARLKRATVKNPQARIKVNRGDLPVIKLGNARVVLSRRRRRKKGQRSSLKGGGSVLVVGNRRIPGAFIQQLKNGRWHVMQRVAGKNRYPIDVVKIPMAVPLTTAFKQNIERIRRERLPKELGYALQHQLRMVIKR vrpp_lambd Replication protein P P protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MKNIAAQMVNFDREQMRRIANNMPEQYDEKPQVQQVAQIINGVFSQLLATFPASLANRDQNEVNEIRRQWVLAFRENGITTMEQVNAGMRVARRQNRPFLPSPGQFVAWCREEASVTAGLPNVSELVDMVYEYCRKRGLYPDAESYPWKSNAHYWLVTNLYQNMRANALTDAELRRKAADELVHMTARINRGEAIPEPVKQLPVMGGRPLNRAQALAKIAEIKAKFGLKGASV vrpo_lambd Replication protein O O protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MTNTAKILNFGRGNFAGQERNVADLDDGYARLSNMLLEAYSGADLTKRQFKVLLAILRKTYGWNKPMDRITDSQLSEITKLPVKRCNEAKLELVRMNIIKQQGGMFGPNKNISEWCIPQNEGKSPKTRDKTSLKLGDCYPSKQGDTKDTITKEKRKDYSSENSGESSDQPENDLSVVKPDAAIQSGSKWGTAEDLTAAEWMFDMVKTIAPSARKPNFAGWANDIRLMRERDGRNHRDMCVLFRWACQDNFWSGNVLSPAKLRDKWTQLEINRNKQQAGVTASKPKLDLTNTDWIYGVDLKTSPHRWLTLTVSRCVGSPTTCRNSTTKSRRYSR c6zcx4_9caud ECD_10033 protein protein enterobacteria phage de3 enterobacteria phage de3 MKTFLIFDINHQQNTRRSDQIETIKTIMQTTRPRITWKVLPMAQVAIFKEIFDQVRKDLDCELFYSELKRHNVSHYIYYLATDNIHIVLENDNTVLIKGLKKVVNVKFSRNTHLIETSYDRLKSREITFQQYRENLAKAGVFRWVTNIHEHKRYYYTFDNSLLFTESIQNTTQIFPR q38267_lambd protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MHKASSVELRTSIEMAHSLAQIGIRFVPIPVETDEEFHTLAASLSQKLEMMVAKAEADERNQV span2_lambd Spanin, outer lipoprotein subunit Rz1 Outer membrane lipoprotein Rz1 Lysis protein Rz1 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MLKLKMMLCVMMLPLVVVGCTSKQSVSQCVKPPPPPAWIMQPPPDWQTPLNGIISPSERG rexb_lambd Protein rexB rexB lambdap53 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MRNRIMPGVYIVIIPYVIVSICYLLFRHYIPGVSFSAHRDGLGATLSSYAGTMIAILIAALTFLIGSRTRRLAKIREYGYMTSVVIVYALSFVELGALFFCGLLLLSSISGYMIPTIAIGIASASFIHICILVFQLYNLTREQE tttp_lambd Tail tube terminator protein U Tail sheath-stabilizing protein Gene product U Minor tail protein U Tail-to-head joining protein lambdap12 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSSADLTYVITYEM nine_lambd Protein ninE ninE Nin60 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MARQRRSITDIICENCKYLPTKRTRNKPKPIPKESDVKTFNYTAHLWDIRWLRRRARKTR vxis_lambd Excisionase xis protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MYLTLQEWNARQRRPRSLETVRRWVRECRIFPPPVKDGREYLFHESAVKVDLNRPVTGGLLKRIRNGKKAKS hcp_lambd Head completion protein W Head-tail joining protein W lambdap03 protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MTRQEELAAARAALHDLMTGKRVATVQKDGRRVEFTATSVSDLKKYIAELEVQTGMTQRRRGPAGFYV a-a 1189395 n/a 1189396 unspecified role unspecified role prey prey n/a 1189396 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 3 Table 3 3 a-bet 1189395 n/a 1189397 unspecified role unspecified role prey prey n/a 1189396 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 a-fi 1189395 n/a 1189398 unspecified role unspecified role prey prey n/a 1189396 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 3 Table 3 3 a-ninf 1189395 n/a 1189396 unspecified role unspecified role bait bait n/a 1189399 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 a-nu1 1189395 n/a 1189396 unspecified role unspecified role bait bait n/a 1189400 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 3 Table 3 3 a-sieb 1189395 n/a 1189396 unspecified role unspecified role bait bait n/a 1189401 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 a-v 1189395 n/a 1189402 unspecified role unspecified role prey prey n/a 1189396 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 ci-ci-1 1189395 n/a 1189403 unspecified role unspecified role prey prey n/a 1189403 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 ci-kil 1189395 n/a 1189404 unspecified role unspecified role prey prey n/a 1189403 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 cii-cii 1189395 n/a 1189405 unspecified role unspecified role bait bait n/a 1189405 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 c-c 1189395 n/a 1189406 unspecified role unspecified role prey prey n/a 1189406 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 c-c-1 1189395 n/a 1189406 unspecified role unspecified role bait bait n/a 1189406 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 c-c6zcx5 1189395 n/a 1189407 unspecified role unspecified role prey prey n/a 1189406 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 d-d-1 1189395 n/a 1189408 unspecified role unspecified role prey prey n/a 1189408 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 d-e 1189395 n/a 1189409 unspecified role unspecified role prey prey n/a 1189408 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 e-fi 1189395 n/a 1189409 unspecified role unspecified role bait bait n/a 1189398 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 4 Table 3 4 e-c-2 1189395 n/a 1189406 unspecified role unspecified role prey prey n/a 1189409 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 ea8_5-ea8_5 1189395 n/a 1189410 unspecified role unspecified role prey prey n/a 1189410 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 ea8_5-int 1189395 n/a 1189411 unspecified role unspecified role prey prey n/a 1189410 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 e-e 1189395 n/a 1189409 unspecified role unspecified role prey prey n/a 1189409 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 ea8_5-tfa 1189395 n/a 1189412 unspecified role unspecified role prey prey n/a 1189410 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 ea8_5-stf 1189395 n/a 1189410 unspecified role unspecified role bait bait n/a 1189413 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 ea8_5-q 1189395 n/a 1189410 unspecified role unspecified role bait bait n/a 1189414 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 ea8_5-ren 1189395 n/a 1189410 unspecified role unspecified role bait bait n/a 1189415 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 fi-ninb 1189395 n/a 1189398 unspecified role unspecified role bait bait n/a 1189416 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 g-g 1189395 n/a 1189417 unspecified role unspecified role prey prey n/a 1189417 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 3 Table 3 3 g-h 1189395 n/a 1189417 unspecified role unspecified role bait bait n/a 1189418 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 g-s 1189395 n/a 1189417 unspecified role unspecified role bait bait n/a 1189419 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 g-t 1189395 n/a 1189420 unspecified role unspecified role prey prey n/a 1189417 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 h-cii 1189395 n/a 1189405 unspecified role unspecified role prey prey n/a 1189418 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 h-ren 1189395 n/a 1189415 unspecified role unspecified role prey prey n/a 1189418 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 h-v 1189395 n/a 1189418 unspecified role unspecified role bait bait n/a 1189402 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 int-a 1189395 n/a 1189396 unspecified role unspecified role prey prey n/a 1189411 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 int-bet 1189395 n/a 1189397 unspecified role unspecified role prey prey n/a 1189411 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 int-int 1189395 n/a 1189411 unspecified role unspecified role prey prey n/a 1189411 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 int-sieb 1189395 n/a 1189401 unspecified role unspecified role prey prey n/a 1189411 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 int-tfa 1189395 n/a 1189411 unspecified role unspecified role bait bait n/a 1189412 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 int-v 1189395 n/a 1189411 unspecified role unspecified role bait bait n/a 1189402 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 m-fi 1189395 n/a 1189398 unspecified role unspecified role prey prey n/a 1189421 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 m-g 1189395 n/a 1189421 unspecified role unspecified role bait bait n/a 1189417 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 3 Table 3 3 m-ninf 1189395 n/a 1189421 unspecified role unspecified role bait bait n/a 1189399 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 m-c 1189395 n/a 1189421 unspecified role unspecified role bait bait n/a 1189406 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 m-c6zcu7 1189395 n/a 1189421 unspecified role unspecified role bait bait n/a 1189422 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 n-bet 1189395 n/a 1189397 unspecified role unspecified role prey prey n/a 1189423 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 n-ea47 1189395 n/a 1189424 unspecified role unspecified role prey prey n/a 1189423 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 n-l 1189395 n/a 1189423 unspecified role unspecified role bait bait n/a 1189425 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 n-nu1 1189395 n/a 1189400 unspecified role unspecified role prey prey n/a 1189423 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 n-v-4 1189395 n/a 1189423 unspecified role unspecified role bait bait n/a 1189402 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 nind-cro 1189395 n/a 1189426 unspecified role unspecified role bait bait n/a 1189427 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 nind-k 1189395 n/a 1189426 unspecified role unspecified role bait bait n/a 1189428 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 pp-n 1189395 n/a 1189423 unspecified role unspecified role prey prey n/a 1189429 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 nind-q 1189395 n/a 1189414 unspecified role unspecified role prey prey n/a 1189426 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 pp-q 1189395 n/a 1189429 unspecified role unspecified role bait bait n/a 1189414 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 nu1-nu1 1189395 n/a 1189400 unspecified role unspecified role prey prey n/a 1189400 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 nu1-tfa 1189395 n/a 1189400 unspecified role unspecified role bait bait n/a 1189412 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 nu1-y64 1189395 n/a 1189430 unspecified role unspecified role prey prey n/a 1189400 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 nu1-r 1189395 n/a 1189431 unspecified role unspecified role prey prey n/a 1189400 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 nu1-v 1189395 n/a 1189402 unspecified role unspecified role prey prey n/a 1189400 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 c-c-1 1189395 n/a 1189406 unspecified role unspecified role prey prey n/a 1189406 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 c-z 1189395 n/a 1189406 unspecified role unspecified role bait bait n/a 1189432 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 o-p 1189395 n/a 1189433 unspecified role unspecified role prey prey n/a 1189434 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 c6zcu7-cii 1189395 n/a 1189405 unspecified role unspecified role prey prey n/a 1189422 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 c6zcu7-int 1189395 n/a 1189411 unspecified role unspecified role prey prey n/a 1189422 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 c6zcu7-k 1189395 n/a 1189428 unspecified role unspecified role prey prey n/a 1189422 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 c6zcu7-c6zcx4-1 1189395 n/a 1189435 unspecified role unspecified role prey prey n/a 1189422 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Protein sequence for c6zcx4_lambd was supplied and matches only the sub-strain DE3 of LAMBD. Table 3 1 c6zcu7-ren 1189395 n/a 1189422 unspecified role unspecified role bait bait n/a 1189415 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 sieb-sieb 1189395 n/a 1189401 unspecified role unspecified role prey prey n/a 1189401 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 c6zcx5-c6zcx5 1189395 n/a 1189407 unspecified role unspecified role bait bait n/a 1189407 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 q38267-n 1189395 n/a 1189423 unspecified role unspecified role prey prey n/a 1189436 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 q38267-c6zcx4-1 1189395 n/a 1189435 unspecified role unspecified role prey prey n/a 1189436 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Protein sequence for c6zcx4_lambd was supplied and matches only the sub-strain DE3 of LAMBD. Table 3 1 q38267-p 1189395 n/a 1189433 unspecified role unspecified role prey prey n/a 1189436 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 q38267-q 1189395 n/a 1189436 unspecified role unspecified role bait bait n/a 1189414 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 q38267-ren 1189395 n/a 1189436 unspecified role unspecified role bait bait n/a 1189415 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 q38267-rz1 1189395 n/a 1189437 unspecified role unspecified role prey prey n/a 1189436 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 p-bet 1189395 n/a 1189397 unspecified role unspecified role prey prey n/a 1189433 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 p-q 1189395 n/a 1189433 unspecified role unspecified role bait bait n/a 1189414 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 rexb-a 1189395 n/a 1189396 unspecified role unspecified role prey prey n/a 1189438 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 rexb-sieb 1189395 n/a 1189401 unspecified role unspecified role prey prey n/a 1189438 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 rexb-c6zcx4-1 1189395 n/a 1189435 unspecified role unspecified role prey prey n/a 1189438 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Protein sequence for c6zcx4_lambd was supplied and matches only the sub-strain DE3 of LAMBD. Table 3 1 rexb-ren 1189395 n/a 1189438 unspecified role unspecified role bait bait n/a 1189415 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 s-s-1 1189395 n/a 1189419 unspecified role unspecified role prey prey n/a 1189419 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 u-ea47 1189395 n/a 1189424 unspecified role unspecified role prey prey n/a 1189439 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 u-ninb 1189395 n/a 1189439 unspecified role unspecified role bait bait n/a 1189416 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 u-nine 1189395 n/a 1189440 unspecified role unspecified role prey prey n/a 1189439 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 u-ninf 1189395 n/a 1189399 unspecified role unspecified role prey prey n/a 1189439 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 u-u 1189395 n/a 1189439 unspecified role unspecified role prey prey n/a 1189439 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 u-xis 1189395 n/a 1189439 unspecified role unspecified role bait bait n/a 1189441 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 v-g 1189395 n/a 1189417 unspecified role unspecified role prey prey n/a 1189402 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 w-xis 1189395 n/a 1189441 unspecified role unspecified role prey prey n/a 1189442 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 u-ci 1189395 n/a 1189439 unspecified role unspecified role bait bait n/a 1189403 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 m-rz1 1189395 n/a 1189421 unspecified role unspecified role bait bait n/a 1189437 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 c6zcx5-ninb 1189395 n/a 1189416 unspecified role unspecified role prey prey n/a 1189407 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 int-g-1 1189395 n/a 1189411 unspecified role unspecified role bait bait n/a 1189417 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 2 Table 3 2 ea8_5-ninb 1189395 n/a 1189416 unspecified role unspecified role prey prey n/a 1189410 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 s-ninb 1189395 n/a 1189419 unspecified role unspecified role bait bait n/a 1189416 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 s-rz1 1189395 n/a 1189437 unspecified role unspecified role prey prey n/a 1189419 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Table 3 1 u-c6zcx4-1 1189395 n/a 1189439 unspecified role unspecified role bait bait n/a 1189435 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 1 Protein sequence for c6zcx4_lambd was supplied and matches only the sub-strain DE3 of LAMBD. Table 3 1