Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com www.molecularconnections.com aksaas-2011-1 G-patch domain and KOW motifs-containing protein, GPKOW; a nuclear RNA-binding protein regulated by protein kinase A. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid protein sequence protein sequence identification protein sequence Aksaas A.K., Larsen A.C., Rogne M., Rosendal K., Kvissel A.K., Skalhegg B.S. Human peripheral blood cDNA J Mol Signal 2011 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd aksaas-2011-2 G-patch domain and KOW motifs-containing protein, GPKOW; a nuclear RNA-binding protein regulated by protein kinase A. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Aksaas A.K., Larsen A.C., Rogne M., Rosendal K., Kvissel A.K., Skalhegg B.S. Human peripheral blood cDNA J Mol Signal 2011 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd aksaas-2011-5 G-patch domain and KOW motifs-containing protein, GPKOW; a nuclear RNA-binding protein regulated by protein kinase A. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Aksaas A.K., Larsen A.C., Rogne M., Rosendal K., Kvissel A.K., Skalhegg B.S. Human peripheral blood cDNA J Mol Signal 2011 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd aksaas-2011-3 G-patch domain and KOW motifs-containing protein, GPKOW; a nuclear RNA-binding protein regulated by protein kinase A. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Aksaas A.K., Larsen A.C., Rogne M., Rosendal K., Kvissel A.K., Skalhegg B.S. Human peripheral blood cDNA J Mol Signal 2011 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd aksaas-2011-4 G-patch domain and KOW motifs-containing protein, GPKOW; a nuclear RNA-binding protein regulated by protein kinase A. in vitro In vitro phosphatase assay phosphatase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Aksaas A.K., Larsen A.C., Rogne M., Rosendal K., Kvissel A.K., Skalhegg B.S. Human peripheral blood cDNA J Mol Signal 2011 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd p22694-2 cAMP-dependent protein kinase catalytic subunit beta Beta2 PRKACB protein protein human Homo sapiens Human MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWDRSMKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF gpkow_human G-patch domain and KOW motifs-containing protein Protein MOS2 homolog Protein T54 GPKOW GPATC5 GPATCH5 T54 G-patch domain-containing protein 5 protein protein human Homo sapiens Human MADSKEGVLPLTAASTAPISFGFTRTSARRRLADSGDGAGPSPEEKDFLKTVEGRELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEAVPVEAYGLAMLRGMGWKPGEGIGRTFNQVVKPRVNSLRPKGLGLGANLTEAQALTPTGPSRMPRPDEEQEKDKEDQPQGLVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPVSQQEFDKNTLDLRQQNGTASSRKTLWNQELYIQQDNSERKRKHLPDRQDGPAAKSEKAAPRSQHWLHRDLRVRFVDNMYKGGQYYNTKMIIEDVLSPDTCVCRTDEGRVLEGLREDMLETLVPKAEGDRVMVVLGPQTGRVGHLLSRDRARSRALVQLPRENQVVELHYDAICQYMGPSDTDDD kap0_human cAMP-dependent protein kinase type I-alpha regulatory subunit Tissue-specific extinguisher 1 PRKAR1A PKR1 PRKAR1 TSE1 protein protein human Homo sapiens Human MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQGETDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV p22694-1 cAMP-dependent protein kinase catalytic subunit beta Beta1 PRKACB protein protein human Homo sapiens Human MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF p17612-1 cAMP-dependent protein kinase catalytic subunit alpha C-alpha-1 PRKACA PKACA protein protein human Homo sapiens Human MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF ppbi_bovin Intestinal-type alkaline phosphatase ALPI protein protein bovin Bos taurus (Bovine) Bovine MQGACVLLLLGLHLQLSLGLVPVEEEDPAFWNRQAAQALDVAKKLQPIQTAAKNVILFLGDGMGVPTVTATRILKGQMNGKLGPETPLAMDQFPYVALSKTYNVDRQVPDSAGTATAYLCGVKGNYRTIGVSAAARYNQCKTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDADLPADAQMNGCQDIAAQLVNNMDIDVILGGGRKYMFPVGTPDPEYPDDASVNGVRKRKQNLVQAWQAKHQGAQYVWNRTALLQAADDSSVTHLMGLFEPADMKYNVQQDHTKDPTLQEMTEVALRVVSRNPRGFYLFVEGGRIDHGHHDDKAYMALTEAGMFDNAIAKANELTSELDTLILVTADHSHVFSFGGYTLRGTSIFGLAPSKALDSKSYTSILYGNGPGYALGGGSRPDVNDSTSEDPSYQQQAAVPQASETHGGEDVAVFARGPQAHLVHGVEEETFVAHIMAFAGCVEPYTDCNLPAPTTATSIPDAAHLAASPPPLALLAGAMLLLLAPTLY prkacb-gpkow 1240112 n/a 1240117 unspecified role unspecified role bait bait n/a 1240118 unspecified role unspecified role prey prey physical association physical association false false false Additional fugure 1 prkacb-prkar1a 1240112 n/a 1240119 unspecified role unspecified role prey prey n/a 1240117 unspecified role unspecified role bait bait physical association physical association false false false Additional figure 1 gpkow-prkacb 1240113 n/a 1240118 unspecified role unspecified role bait bait n/a 1240117 unspecified role unspecified role prey prey c-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false fig. 2a prkar1a-prkacb-1 1240113 n/a 1240119 unspecified role unspecified role bait bait n/a 1240120 unspecified role unspecified role prey prey physical association physical association false false false fig. 2c prkacb-gpkow-2 1240114 n/a 1240118 unspecified role unspecified role prey prey c-term v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1240117 unspecified role unspecified role bait bait physical association physical association false false false fig. 2a gpkow-prkacb-1 1240114 n/a 1240117 unspecified role unspecified role prey prey c-term v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1240118 unspecified role unspecified role bait bait physical association physical association false false false fig. 2a gpkow-prkaca 1240115 n/a 1240121 enzyme target enzyme target substrate substrate unspecified role unspecified role n/a 1240118 enzyme enzyme unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation false false false fig. 5b In Ser27Ala and Thr316Ala GPKOW mutants, phosphorylation was decreased compared to wild type, suggesting these may be phosphorylation sites. alpi-gpkow 1240116 n/a 1240122 enzyme enzyme unspecified role unspecified role bovin Bos taurus (Bovine) Bovine n/a 1240118 enzyme target enzyme target substrate substrate unspecified role unspecified role human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. dephosphorylation dephosphorylation reaction dephosphorylation false false false fig. 5d