MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint ospina-2011-1 Protein oligomerization mediated by the transmembrane carboxyl terminal domain of Bcl-XL. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. crosslink cross-linking study crosslink predetermined predetermined participant predetermined Ospina A., Lagunas-Martínez A., Pardo J., Carrodeguas JA. FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation ospina-2011-2 Protein oligomerization mediated by the transmembrane carboxyl terminal domain of Bcl-XL. in vitro In vitro bn-page blue native page bn-page predetermined predetermined participant predetermined Ospina A., Lagunas-Martínez A., Pardo J., Carrodeguas JA. FEBS Lett. (0014-5793) 2011 Only protein-protein interactions imex curation b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST bcl2l1-1 1173532 b2cl1_human Bcl-Xl 1173534 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 physical association physical association false false false mint f3a f6 vamp2-5 1173532 vamp2_rat Vamp2 1173535 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 physical association physical association false false false mint f3a f6 bcl2l1-1 1173533 b2cl1_human Bcl-Xl 1173534 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 physical association physical association false false false f3b mint vamp2-5 1173533 vamp2_rat Vamp2 1173535 anti tag western anti tag western blot anti tag western unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 physical association physical association false false false f3b mint