MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint miertzschke-2011-1 Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Miertzschke M., Koerner C., Vetter IR., Keilberg D., Hot E., Leonardy S., Søgaard-Andersen L., Wittinghofer A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation miertzsc-2011-1 Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Miertzschke M., Koerner C., Vetter IR., Keilberg D., Hot E., Leonardy S., Søgaard-Andersen L., Wittinghofer A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation miertzsc-2011-2 Structural analysis of the Ras-like G protein MglA and its cognate GAP MglB and implications for bacterial polarity. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Miertzschke M., Koerner C., Vetter IR., Keilberg D., Hot E., Leonardy S., Søgaard-Andersen L., Wittinghofer A. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation q5sj82_thet8 TTHA1132 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MSTINFANREINFKIVYYGPGLSGKTTNLKWIYSKVPEGRKGEMVSLATEDERTLFFDFLPLDIGEVKGFKTRFHLYTVPGQVFYNASRKLILRGVDGIVFVADSAPNRLRANAESMRNMRENLAEYGLTLDDVPIVIQVNKRDLPDALPVEMVRAVVDPEGKFPVLEAVATEGKGVFETLKEVSRLVLARVAGGS mint q5sj83_thet8 TTHA1131 protein protein thet8 Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) MVEPSLVLYGAPYERAVEVLEETLRETGARYALLIDRKGFVLAHKEALWAPKPPPLDTLATLVAGNAAATQALAKLLGEARFQEEVHQGERMGLYVDEAGEHALLVLVFDETAPLGKVKLHGKRAAEALARIAEEALANPPRLALDTEYREGAEALLDDLLRN mint q5sj82-q5sj83 1247026 mgla mglA 1247029 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.2 mglb mglB 1247030 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.1 direct interaction direct interaction false false false mint f3a sf1 sf3 q5sj83 1247026 mglb mglB 1247030 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint st1 st2 sf3b sf4 f2b q5sj82-1 1247026 mgla mglA 1247029 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint sf1 st1 st2 q5sj83-1 1247026 mglb mglB 1247030 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false mint st1 st2 sf3 q5sj82-q5sj83-1 1247027 mgla mglA 1247029 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.2 mglb mglB 1247030 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.1 direct interaction direct interaction false false false 1247027 mint f3b f5 f7 q5sj82-q5sj83-2 1247027 mgla mglA 1247029 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.2 mglb mglB 1247030 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q5SJ83:p.Ala72Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q5SJ83:p.Ala68Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.1 direct interaction direct interaction false false false 1247027 mint f3b f5 q5sj82-q5sj83-3 1247028 mgla mglA 1247029 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 1.2 mglb mglB 1247030 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q5SJ83:p.Ala68Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Q5SJ83:p.Ala72Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.1 direct interaction direct interaction false false false mint f3c f3d sf2c sf5a