MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint kaur-2011-2 Truncation of the Mrp20 protein reveals new ribosome-assembly subcomplex in mitochondria. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kaur J., Stuart RA. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation kaur-2011-1 Truncation of the Mrp20 protein reveals new ribosome-assembly subcomplex in mitochondria. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Kaur J., Stuart RA. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation kaur-2011-3 Truncation of the Mrp20 protein reveals new ribosome-assembly subcomplex in mitochondria. in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Kaur J., Stuart RA. EMBO Rep. (1469-221X) 2011 Only protein-protein interactions imex curation rm40_yeast 54S ribosomal protein L40, mitochondrial YPL173W MRPL40 YmL40 Mitochondrial large ribosomal subunit protein uL24m protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGSYQHLSNVGSRVMKRLGNRPKNFLPHSEKFIKKSTPEFMKSDLKEVDEKTSFKSEKEWKFIPGDRVVVMSGASKGNIAVIKSFDKRTNSFILDENGPTKTVPVPKQFWLEGQTSHMITIPVSILGKDLRLVADIDDEKTPGKTRTVAVRDVSFNGSYYDADYKKVMPYRCVKGQPDLIIPWPKPDPIDVQTNLATDPVIAREQTFWVDSVVRNPIPKKAIPSIRNPHSKYKRGTLTAKDIAKLVAPEMPLTEVRKSHLAEKKELAEREVPKLTEEDMEAIGARVFEFLEKQKRE D5BB2B7AE13ECBF9 prx1_yeast Peroxiredoxin PRX1, mitochondrial PRX1 1-Cys PRX Mitochondrial thiol peroxidase Thioredoxin peroxidase YBL0503 YBL0524 YBL064C Glutaredoxin-dependent peroxiredoxin Glutathione-dependent peroxiredoxin protein protein yeast Saccharomyces cerevisiae Baker's yeast MFSRICSAQLKRTAWTLPKQAHLQSQTIKTFATAPILCKQFKQSDQPRLRINSDAPNFDADTTVGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDVESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVIDPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDEAKAKFGQFNEIKPYLRFTKSK F611A9ED85E4681A rm04_yeast 54S ribosomal protein L4, mitochondrial MRPL4 YLR439W L9753.1 YmL4 Mitochondrial large ribosomal subunit protein uL29m protein protein yeast Saccharomyces cerevisiae Baker's yeast MWKRSFHSQGGPLRARTKFTKPKPKQPVLPKDKIRPPTQLTHHSNNLRITEPIPPTTSNLRCPDDHPLWQFFSNKKFIRSADDLPPSSHIRPWSIPELRHKSFNDLHSLWYNCLREQNVLARENHLLKNIVGSTHDEFSELSNSIRTTMWQIRHVLNERELAYSASREFLQDESERKKFLDTLANDYFLNKDIPDDEVASMLTRFQLAIFGISETIQDNTVDINFIDGIKFLANLKLQRFKDSNDLISEISQEPITDVGESFILFTSDFEPHAVQEACVAIKDLRKSPDNKVPKLDELPTVRKYLKQLIHASSVEQATA 2DE880E9BFE19BC9 rm41_yeast 54S ribosomal protein L41, mitochondrial MRP20 MRPL41 YDR405W D9509.23 YmL41 Mitochondrial large ribosomal subunit protein uL23m protein protein yeast Saccharomyces cerevisiae Baker's yeast MPRLTVGTKNMLYPLQKTLAVGSCKPEQVPIRSLASVVESSSKILDKSGSDREVDINVSEKIYKWTKAGIEQGKEHFKVGGNKVYFPKARIILLRPNAKHTPYQAKFIVPKSFNKLDLRDYLYHIYGLRAMNITTQLLHGKFNRMNLQTTRFREPQIKKMTIEMEEPFIWPEEPRPDENSFWDSTTPDNMEKYREERLNCLGSDANKPGTAFDGVVGPYERVAQPFIPRFLKREIDNKRERHAAELQRADKLIALNRYIEDLH B8B1E51BAC60C673 rm27_yeast 54S ribosomal protein L27, mitochondrial MRPL27 YBR282W YBR2019 YmL27 Mitochondrial large ribosomal subunit protein mL41 protein protein yeast Saccharomyces cerevisiae Baker's yeast MKGSPISQFSKTSINALTRPWKKYRDGELFYGLSKVGNKRVPLTTKQGNKTMYKGTRASGIGRHTKFGGYVINWKKVRTYVTPDMVNFELKPYVNANVPPLKHEFKGFSGGPLDPRLQLLKIKEYIVNGRVQSEGATDTSCYKERG 0BB2E6D8A0E49213 rm25_yeast 54S ribosomal protein L25, mitochondrial MRPL25 YMR26 YGR076C YmL25 Mitochondrial large ribosomal subunit protein mL59 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSYKQYFDSLPLKLKSFFQRYPPSIKYSPVSTSTKAINANPFLPNKHPVTQRFHDPKYSLRRMSDVYKLALRYGVEEFLPPIENTKKLFFEEKYNKKTLMKGVLLPKGHKHELKLNEKLKKREEALKKVDELIASKKGSKYAKRVEKMKKNQSIGWF DAB3B47998D6CEEB rm36_yeast 54S ribosomal protein L36, mitochondrial MRPL36 YBR122C YBR0918 YmL36 Mitochondrial large ribosomal subunit protein bL31m protein protein yeast Saccharomyces cerevisiae Baker's yeast MLKSIFAKRFASTGSYPGSTRITLPRRPAKKIQLGKSRPAIYHQFNVKMELSDGSVVIRRSQYPKGEIRLIQDQRNNPLWNPSRDDLVVVDANSGGSLDRFNKRYSSLFSVDSTTPNSSSETVELSEENKKKTQIKKEEKEDVSEKAFGMDDYLSLLDDSEQQIKSGKLASKKRDKK 7A8DF86EE899B848 rm02_yeast 54S ribosomal protein L2, mitochondrial MRP7 MRPL2 YmL2 YMR6 N2007 YNL005C Mitochondrial large ribosomal subunit protein bL27m protein protein yeast Saccharomyces cerevisiae Baker's yeast MWNPILLDTSSFSFQKHVSGVFLQVRNATKRAAGSRTSMKDSAGRRLGPKKYEGQDVSTGEIIMRQRGTKFYPGENVGIGKDHSIFALEPGVVRYYLDPFHPKRKFIGVALRRDLKLPSPHFEPTVRRFGRFELTNKRAAYKEENSISRKDYLAKPNILKQLEVRESKRKELQDKLSKVLRDELKLDIKDIELATSYLIRVRASLKNGYPIEDARFNSRYYLKEEERLKARRESWTNEKLSESLSKIDECSDLLNSSTSFNNKLELHQYISEQEKQALKAKLLEDLEKSQHLETKKDKNYIKALFKDACNFLTLSEEVHLRRKYLKSVFPETDSTVETKSGKKSIVSRRFDYTKNKVEVIARSRRAFLSKL F8F17EF955BB7ACF rm49_yeast 54S ribosomal protein MRP49, mitochondrial MRP49 Mitochondrial large ribosomal subunit protein mL61 YKL631 YKL167C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKVAQQLKFLNKISATTRLPQILVDPKKYSGLRLTFQTKNHNGHMGARVFWHNYLPTLQFYNPRMKFDVIRIKNEDKQKSVPCKLEILSHEGSVVETIDMRNKMHEDIMKDLLDKIEHVPLPENEIIRVGPQESII mrp20-mrpl4-1 1242880 rm40_yeast MRPL40 1242883 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level prx1_yeast PRX1 1242884 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm04_yeast MRPL4 1242885 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false f3d mint mrp20-mrpl25 1242880 rm27_yeast MRPL27 1242887 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm41_yeast MRP20 1242886 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rm40_yeast MRPL40 1242883 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm25_yeast MRPL25 1242888 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level prx1_yeast PRX1 1242884 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm04_yeast MRPL4 1242885 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false mint f3c st1 mrp20-mrpl4-2 1242880 rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rm40_yeast MRPL40 1242883 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm04_yeast MRPL4 1242885 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false mint f3f sf3b mrpl25-mrp20 1242880 rm40_yeast MRPL40 1242883 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm25_yeast MRPL25 1242888 predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rm41_yeast MRPL20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rm04_yeast MRPL4 1242885 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f3f mint mrpl27-mrp20 1242880 rm04_yeast MRPL4 1242885 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm27_yeast MRPL27 1242887 predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rm40_yeast MRPL40 1242883 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false f3f mint prx1-mrp20 1242880 rm04_yeast MRPL4 1242885 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm36_yeast MRPL36 1242889 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm02_yeast MRP7 1242890 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm40_yeast MRPL40 1242883 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm49_yeast MRP49 1242891 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level prx1_yeast PRX1 1242884 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false f3g mint mrp20-mrpl40 1242880 rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rm40_yeast MRPL40 1242883 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false sf2 mint mrp20-mrp49 1242881 rm49_yeast MRP49 1242891 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm40_yeast MRPL40 1242883 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm36_yeast MRPL36 1242889 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false f2b mint mrp20-mrpl4 1242881 rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rm04_yeast MRPL4 1242885 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm40_yeast MRPL40 1242883 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false f2d mint mrp20-mrpl36 1242882 rm41_yeast MRP20 1242886 western blot western blot Immuno blot Immuno blot unspecified role unspecified role unspecified role unspecified role subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false rm36_yeast MRPL36 1242889 western blot western blot Immuno blot Immuno blot unspecified role unspecified role unspecified role unspecified role subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level rm40_yeast MRPL40 1242883 western blot western blot Immuno blot Immuno blot unspecified role unspecified role unspecified role unspecified role subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false f4a mint