MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schwintzer-2011-1 The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation schwintz-2011-4 The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation schwintz-2011-1 The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation schwintz-2011-2 The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. rat-brain Rattus norvegicus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation schwintz-2011-3 The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. rat-hippocampus_neuron Rattus norvegicus brain-hippocampus_neuron Hippocampal neuron fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation schwintz-2011-5 The functions of the actin nucleator Cobl in cellular morphogenesis critically depend on syndapin I. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Schwintzer L., Koch N., Ahuja R., Grimm J., Kessels MM., Qualmann B. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation cobl_mouse Protein cordon-bleu Cobl Kiaa0633 protein protein mouse Mus musculus Mouse MDAPRALAAKPPTGRKMKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVYMKEALQNSTLDITVVLPSGLEKQSVVSGSHAMMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNVHTVLLKEKVPEERVKPGLTKAPEKSVRLVVNYLRTQKAVVRVSPEVPLQNILPVICAKCEVNPEHVILLRDNVAGEELELSKSLNELGIKELYAWDNRREMFRKSSLGNDETDKEKKKFLGFFKANKRSNSKAEHLGLSGADSDEDPAKSASGGDLNGCVTTPNSPSLHSRSLTLGPSLSLGNISGVSMKSDMKKRRAPPPPSPKLLGQDKVSEKASLSSQADLQKKKRRAPAPPPPQQPPPSPVVPNRKEDKEENRKSTVGVGRQVPQKPPRGTARGPPQLVLPPPPPYPPPDTDVTEPVTFPGEGAGSETSELRPKLSLPLGPGSHCSMGGVSQVPAESEETASEDTTEDSGVMSSPSDAISLDSQQDSMRSKDKWSTDQEDGSDQDLAGTPELGPQKSPSWGKSGSGSSILRTEKATMPTNDDEDLFITGHLHQTLAELDEDLEGMEENYETDTSSLTNSVNGVSNHSLQEAIIPDSGVDDIPVTFIGEVSDEPFDSGLFSSRCNNATTFNTGSIASQRSHLSPSQTEHSQPFVRTSRKEPDPSPPSQDNRKRNQPTLANTSENENPVETDPTVTSLVSKLLIDDPKAKDKGKVHGSSHSEKTQAGHGINSLRVNPRDGKDESSNSAPPPWSHHGQALGGSYGLKYGLTTYKIVPPKSEMRCYDRDVSLSTGAIKIDELGNLVSPHMNGSRTISPPSAVVETDTPPIGKVKEFWRRNSMEKYLNGPAECTIKRAPSTTITATPEKPQQDNGMKAAFTVTTPQQQPASQEYGAHLEEERSRPQSAVSCSVKVPASNPTDITFLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKATTEQCHEEAKLARSPPTRKDDAAPNLHSEARQHEHGTNQSSVCLPSNPGVQLPAGGHPKVEVNSTYGKSSTQDYPAAVHRNSYFLPGRSSHRDRVSVGQSCGFNEKQTTSNQKANSTSNFSQALDKAHPPPLLLAEARDSGRILMNGSARTPGNCEPPHSPKESTLTSYIILQTEEKPSSLSTDGQDADDTLPSSIFGPKKKFKPVIQRPLPKDVSLHSALMEAIHSSGGREKLRKTAEQTSEGRPKKPSYVEAESERSALLAAIRGHSGTLSLRKVSSLASEELQSFRNAALGAPGLDKPQQEDLGLPPPPALPPPPAPAPQAPSASVTVSRFSTGTPSNSVNARQALMDAIRSGTGAARLRKVPLLV pacn1_rat Protein kinase C and casein kinase substrate in neurons protein 1 Pacsin1 Synaptic, dynamin-associated protein I Syndapin-I Dynamin proline-rich domain-interacting protein Syndapin-1 protein protein rat Rattus norvegicus (Rat) Rat MSGPYDEASEEITDSFWEVGNYKRTVKRIDDGHRLCNDLMSCVQERAKIEKAYAQQLTDWAKRWRQLIEKGPQYGSLERAWGAMMTEADKVSELHQEVKNSLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLVDKVDKCRQDVQKTQEKYEKVLEDVGKTTPQYMEGMEQVFEQCQQFEEKRLVFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTAAKKEKQPKKAEGAALSNATGAVESTSQAGDRGSVSSYDRGQAYATEWSDDESGNPFGGNEANGGANPFEDDAKGVRVRALYDYDGQEQDELSFKAGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI pacn2_rat Protein kinase C and casein kinase substrate in neurons 2 protein Synaptic dynamin-associated protein II Syndapin-II Pacsin2 Syndapin-2 protein protein rat Rattus norvegicus (Rat) Rat MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCGDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWMAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVDAAKKAHHTACKEEKLAVSREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKDKYEKALKELDQTTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVASYKGIYRELEQSIKAADAVEDLRWFRANHGPGMAMNWPQFEDEEWSADLNRTLSRREKKKAADGVTLTGINQTGDQSGQNKPSSNLSVPSNPAQSTQLQSSYNPFEDEDDTGSSVSEKEDIKAKNVSSYEKTQNYPADWSDDESNNPFSSTDANGDSNPFDEDTTSGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDSGQVGLYPANYVEAIQ q5i2z0_rat Pacsin3 SdpIII protein protein rat Rattus norvegicus (Rat) Rat MAPEEDAGGEVLVGSFWEAGNYRRTVQRVEDGHRLCGDLISCFQERARIEKAYAQQLADWARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHRPVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKTAQTRESHAKADSSMSQEQLRKLQERVGRCTKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLLFFKDVLLTLHQHLDLSSSDKFHELHRDLQRGIEDASDEEDLRWWRSTHGPGMAMNWPQFEEWSLDTQRAISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPSSPGSGQDEDWSDEESPRKAGTGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVECVGA mint cobl_rat Protein cordon-bleu Cobl protein protein rat Rattus norvegicus (Rat) Rat MKARAPPPPGKPAAQNVHSEQKLPHDATLGSQQSLVHLKEALHNSTLDITVVLPSGLEKQSVVSGSRAVMDLLVELCLQNHLNPSHHVLEIWSSETQQPLSFKPNTLIGSLNAHTVFLKEKVPEEKGKPGLTKAPEKSVRLVVNYLRTQKAVMRVSPEVPLQNILPVICAKCEVSPDHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRREMLRKSSLGNDETDKEKKKFLGFFKVNKRSNSKAEHLGLSGADSDEDPSKSASGGDLNGCVTTPNSPSLHSRSLTLGPSLSLGNISGMSMKSDMKKRRAPPPPSPGLLGQDKVSEKASLSSQADLQKKKRRAPAPPPPQPPPPSPVVPNRKEDKEENRKSTVGMEENYETDTSSLTSSVNGVSNHSLQEAIIPDSGVDDIPVTFIGEVSDEPFDSGLFFSGSNNAAALNQGGIASQRSHLPPYQTEQSQPFIRTNRKEPDPSLPSQDYRKRNQPILANTSENENPVGIDPRVTSFVSKPSTDDPKAKDKDKMCGSGPSEKTQTGHRVNSLPVNPRVGEDENSNSALPPWSHHGQASGGSYGLKYGLTTYKIVPPKPEMRCYDRDVSLSTGAIKIDELGNLMSPHMNGSRTISKPSAVAETEAPPIGKVKEFWRRNSMEKYLNGPAECTVKKAPSTTITATSEKPQRDETKAGFTLTTPEQQPASQEYGAPPEEDRSRPHSAVSCPVKVPAPNPTDITFLKPQRRTSSQYVASAIAKKMGPPKVHADVVRPHKKTAEQGHEEAKLARPPPAWKDSAVPNLCSEAGQCEHGTNQGSVRLPSNPGGQLPADHPKVEVNSTYGKSATHNSPAAVHRNSYFLPGRSSQRDRVSVGQSCGFHEKQTISNQKMNSTSNPSQALDKAHPAPLLLTEARDSGRILVNGSAQTPGNCEPPHSQKESTLTSYIILQTEEKPSPLSADGQNSDDALPSSIFGPKKKFKPVVQRPLPKDISLHSALMEAIHTSGGRDKLRKTAEQASEGRPKKPSYVEAESERSALLAAIRGHSGTLSLRKVSSLASEELQSFRDAALMAPGVDKPQQEDRGLPPPPALPPPSTPASQVPSASIPVSRFSIGTLSNPVNARQALMDAIRSGTGAARLRKVPLLV mint homomint wasl_rat Neural Wiskott-Aldrich syndrome protein Wasl protein protein rat Rattus norvegicus (Rat) Rat MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYSSQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPPLSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPASSGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDEDDDDEEDFQDDDEWED pacsin1-cobl-1 1215688 cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pacn1_rat Syndapin I 1215695 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9Z0W5:p.Pro434Leu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false domino mint f1d f1j f1g pacsin2-cobl 1215688 pacn2_rat Syndapin II 1215696 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false domino mint f1j pacsin3-cobl 1215688 q5i2z0_rat Syndapin III 1215697 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false domino mint f1j pacsin1-cobl-1 1215688 pacn1_rat Syndapin I 1215695 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5d domino mint pacsin1-cobl-1 1215688 pacn1_rat Syndapin I 1215695 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5d domino mint pacsin1-cobl-1 1215688 pacn1_rat Syndapin I 1215695 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false domino mint f5o pacsin1-cobl-1 1215688 cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pacn1_rat Syndapin I 1215695 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false domino mint f5o pacsin1-cobl-1 1215688 pacn1_rat Syndapin I 1215695 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false domino mint f5o cobl-pacsin1-3 1215688 pacn1_rat Syndapin I 1215695 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level cobl Cobl 1215694 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mint f5r pacsin2-cobl-1 1215688 cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pacn2_rat Syndapin II 1215696 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false domino mint sf2d cobl-pacsin1-7 1215689 pacn1_rat Syndapin I 1215695 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5 mint cobl-pacsin1-8 1215689 pacn1_rat Syndapin I 1215695 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f5 mint cobl-pacsin2 1215689 pacn2_rat Syndapin II 1215696 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f5u cobl-pacsin2-1 1215689 pacn2_rat Syndapin II 1215696 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mint f5u cobl-pacsin3 1215689 q5i2z0_rat Syndapin III 1215697 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f5v cobl-pacsin3-1 1215689 q5i2z0_rat Syndapin III 1215697 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f5v pacsin1-cobl-1 1215690 pacn1_rat Syndapin I 1215695 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2d domino mint pacsin1-cobl-1 1215690 pacn1_rat Syndapin I 1215695 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false domino mint f5h pacsin1-cobl-1 1215690 pacn1_rat Syndapin I 1215695 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cobl Cobl 1215694 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false domino mint f5h pacsin1-cobl-1 1215691 cobl Cobl 1215698 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level pacn1_rat Syndapin I 1215695 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false mint f2h cobl-pacsin1-4 1215691 cobl Cobl 1215698 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level pacn1_rat Syndapin I 1215695 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level wasl_rat N-WASP 1215699 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false homomint mint f8o cobl-pacsin1-5 1215692 cobl Cobl 1215698 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell pacn1_rat Syndapin I 1215695 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3c mint cobl-pacsin1-6 1215692 cobl Cobl 1215698 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell pacn1_rat Syndapin I 1215695 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f3f mint cobl-pacsin1-9 1215693 cobl Cobl 1215698 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level pacn1_rat Syndapin I 1215695 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false mint f7o f7p