MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint tsuboi-2011-1 A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans. human-kk-47-c2 Homo sapiens kk-47-c2 kk-47-c2 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Tsuboi S., Sutoh M., Hatakeyama S., Hiraoka N., Habuchi T., Horikawa Y., Hashimoto Y., Yoneyama T., Mori K., Koie T., Nakamura T., Saitoh H., Yamaya K., Funyu T., Fukuda M., Ohyama C. tsuboi@oyokyo.jp EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation tsuboi-2011-2 A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans. human-kk-47-c2 Homo sapiens kk-47-c2 kk-47-c2 crosslink cross-linking study crosslink predetermined predetermined participant predetermined Tsuboi S., Sutoh M., Hatakeyama S., Hiraoka N., Habuchi T., Horikawa Y., Hashimoto Y., Yoneyama T., Mori K., Koie T., Nakamura T., Saitoh H., Yamaya K., Funyu T., Fukuda M., Ohyama C. tsuboi@oyokyo.jp EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation tsuboi-2011-3 A novel strategy for evasion of NK cell immunity by tumours expressing core2 O-glycans. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Tsuboi S., Sutoh M., Hatakeyama S., Hiraoka N., Habuchi T., Horikawa Y., Hashimoto Y., Yoneyama T., Mori K., Koie T., Nakamura T., Saitoh H., Yamaya K., Funyu T., Fukuda M., Ohyama C. tsuboi@oyokyo.jp EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation mica_human MHC class I polypeptide-related sequence A MICA PERB11.1 protein protein human Homo sapiens Human MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI nkg2d_human NKG2-D type II integral membrane protein KLRK1 NKG2D NKG2-D-activating NK receptor NK cell receptor D Killer cell lectin-like receptor subfamily K member 1 D12S2489E protein protein human Homo sapiens Human MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVAIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV mica-lgals3 1190104 mica MICA 1190107 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false leg3_human Galectin-3 1190108 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false homomint mint sf12d mica-lgals3-1 1190105 leg3_human Galectin-3 1190108 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level mica MICA 1190107 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false homomint mint f4k f4l f5b klrk1-mica-2 1190106 mica MICA 1190107 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nkg2-d type ii integ NKG2-D 1190109 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction false false false homomint mint sf14b