MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint rabhi-2011-1 The Sm-like RNA chaperone Hfq mediates transcription antitermination at Rho-dependent terminators. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Rabhi M., Espéli O., Schwartz A., Cayrol B., Rahmouni AR., Arluison V., Boudvillain M. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation rabhi-2011-2 The Sm-like RNA chaperone Hfq mediates transcription antitermination at Rho-dependent terminators. in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Rabhi M., Espéli O., Schwartz A., Cayrol B., Rahmouni AR., Arluison V., Boudvillain M. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation hfq_ecoli RNA-binding protein Hfq hfq b4172 Host factor-I protein HF-1 JW4130 protein protein ecoli Escherichia coli (strain K12) MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTSSNYHHGSSAQNTSAQQDSEETE rho_ecoli Transcription termination factor Rho rho nitA psuA rnsC sbaA tsu b3783 ATP-dependent helicase Rho JW3756 protein protein ecoli Escherichia coli (strain K12) MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKSGEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPPKEGERYFALLKVNEVNFDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFLINKLAMTKTNDDFFEMMKRS nusg_ecoli Transcription termination/antitermination protein NusG nusG b3982 JW3945 protein protein ecoli Escherichia coli (strain K12) MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA This sequence has been withdrawn from Uniprot. rof_ecoli Protein rof yaeO rof b0189 JW0184 protein protein ecoli Escherichia coli (strain K12) MNDTYQPINCDDYDNLELACQHHLMLTLELKDGEKLQAKASDLVSRKNVEYLVVEAAGETRELRLDKITSFSHPEIGTVVVSES hfq-rho 1169903 hfq_ecoli hfq 1169905 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 6.1 rho_ecoli rho 1169906 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified Stoichiometry: 1.6 direct interaction direct interaction false false false mint f1b nusg-rho 1169903 nusg_ecoli nusG 1169907 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rho_ecoli rho 1169906 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false f1c mint rof-rho 1169903 rof_ecoli yaeO 1169908 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rho_ecoli rho 1169906 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false sf1a mint hfq-rho-1 1169904 hfq_ecoli hfq 1169905 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rho_ecoli rho 1169906 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 1169904 sf2 mint