UniProt UniProt http://www.uniprot.org heyd-2011-3 The p150 subunit of the histone chaperone Caf-1 interacts with the transcriptional repressor Gfi1. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Heyd F., Chen R., Afshar K., Saba I., Lazure C., Fiolka K., Moroy T. Source of constructs obtained from the author. florian.heyd@uni-marburg.de Biochim. Biophys. Acta (0006-3002) 2011 mimix curation heyd-2011-4 The p150 subunit of the histone chaperone Caf-1 interacts with the transcriptional repressor Gfi1. human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Heyd F., Chen R., Afshar K., Saba I., Lazure C., Fiolka K., Moroy T. Source of constructs obtained from the author. florian.heyd@uni-marburg.de Biochim. Biophys. Acta (0006-3002) 2011 mimix curation heyd-2011-1 The p150 subunit of the histone chaperone Caf-1 interacts with the transcriptional repressor Gfi1. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Heyd F., Chen R., Afshar K., Saba I., Lazure C., Fiolka K., Moroy T. Source of constructs obtained from the author. florian.heyd@uni-marburg.de Biochim. Biophys. Acta (0006-3002) 2011 mimix curation heyd-2011-2 The p150 subunit of the histone chaperone Caf-1 interacts with the transcriptional repressor Gfi1. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Heyd F., Chen R., Afshar K., Saba I., Lazure C., Fiolka K., Moroy T. Source of constructs obtained from the author. florian.heyd@uni-marburg.de Biochim. Biophys. Acta (0006-3002) 2011 mimix curation heyd-2011-5 The p150 subunit of the histone chaperone Caf-1 interacts with the transcriptional repressor Gfi1. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Heyd F., Chen R., Afshar K., Saba I., Lazure C., Fiolka K., Moroy T. GFP-CAF1A visualised by tag fluorescence Source of constructs obtained from the author. florian.heyd@uni-marburg.de Biochim. Biophys. Acta (0006-3002) 2011 mimix curation heyd-2011-6 The p150 subunit of the histone chaperone Caf-1 interacts with the transcriptional repressor Gfi1. human-hl_60 Homo sapiens acute myeloid leukemia cell line hl_60 human acute myeloid leukemia cell line fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Heyd F., Chen R., Afshar K., Saba I., Lazure C., Fiolka K., Moroy T. Source of constructs obtained from the author. florian.heyd@uni-marburg.de Biochim. Biophys. Acta (0006-3002) 2011 mimix curation heyd-2011-7 The p150 subunit of the histone chaperone Caf-1 interacts with the transcriptional repressor Gfi1. human-hl_60 Homo sapiens acute myeloid leukemia cell line hl_60 human acute myeloid leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Heyd F., Chen R., Afshar K., Saba I., Lazure C., Fiolka K., Moroy T. Source of constructs obtained from the author. florian.heyd@uni-marburg.de Biochim. Biophys. Acta (0006-3002) 2011 mimix curation gfi1_mouse Zinc finger protein Gfi-1 Gfi1 Gfi-1 Growth factor independent protein 1 protein protein mouse Mus musculus Mouse MPRSFLVKSKKAHSYHQPRSPGPDYSLRLETVPAPGRAEGGAVSAGESKMEPRERLSPDSQLTEAPDRASASPNSCEGSVCDPCSEFEDFWRPPSPSVSPASEKSLCRSLDEAQPYTLPFKPYAWSGLAGSDLRHLVQSYRQCSALERSAGLSLFCERGSEPGRPAARYGPEQAAGGAGAGQPGRCGVAGGATSAAGLGLYGDFAPAAAGLYERPSTAAGRLYQDHGHELHADKSVGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK caf1a_mouse Chromatin assembly factor 1 subunit A Chromatin assembly factor I p150 subunit Chaf1a Caip150 protein protein mouse Mus musculus Mouse MLEEPEAATRTAAAVDCKDRPGFPVKRLIQARLPFKRLNLVPKEKVEEDTSPKAAVESKVPDLQLSLGTFESQCHTGSHVGLSTKLVGGQGPIDSFLRATIKPVPSVVIIDLTENCSDIPDSPEGHSELSPDTAGVVTTVEGAAKQQEHSAAELCLLETPSDITCHMEEEPGSPGDPKRTGDCQAGSLQSCPELTPGSRTCPTKELSSWSKAGDLLFIEKVPVVVLEDILATKPSIASLPMMSLDRSVTSESEILESCPEDDSILSHSSTNSSSPTSSPEGPSTPPEHRGGRSSPSTPACRVAKNFVKGSTEKGRSKLHRDREQQREEKEKLREEIRRAKEEARKKKEEEKELKEKERREKREKDEKEKAEKQRLKEEKRKERQEALEAKLEEKRKKEEEKRLREEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRCRAALDQDLCDQLDQLLQQQSVASTFLSDLKSRLPLRSGPTRVCGHDTDIMNRDVVIVESSKVDGVSERKKFGRMKLLQFSENHRPAYWGTWNKKTAIIRPRNPWAQDKDLLDYEVDSDDEWEEEEPGESLSHSEGDEDDDVGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVHQKLKAKEWDELLAKGKRFRVLQPVHVGCVWASEAANCTSSDLKLLQQFTACLLDVASPDEPEPGASRREKRDQHILAQLLPLLHGNVNGSKVIIHEFQEQCRRGLLTLPSPTPHLQMPNLEDAVAVPSKARLKRLISENSAYEKRPNFRMCWYVHPEVLKSFGQECLPVPCQWTYITTMPSAPREDSGSASTEGPGQSTPMLLKRKPAATMCITQFMKKRRYDGQVGSGDMDGFQADTEEDEEDDTDCMIIDVPDVGSDVSEAPIPAPTLCK gfi1_human Zinc finger protein Gfi-1 Growth factor independent protein 1 Zinc finger protein 163 GFI1 ZNF163 protein protein human Homo sapiens Human MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK caf1a_human Chromatin assembly factor 1 subunit A CHAF1A CAF CAF1P150 Chromatin assembly factor I p150 subunit protein protein human Homo sapiens Human MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEASLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLTEDSNEQPDSLVDHNKLNSEASPSREAINGQREDTGDQQGLLKAIQNDKLAFPGETLSDIPCKTEEEGVGCGGAGRRGDSQECSPRSCPELTSGPRMCPRKEQDSWSEAGGILFKGKVPMVVLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDSVLSHSSLSSPSSTSSPEGPPAPPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKLRAEREEKEKLKEEAKRAKEEAKKKKEEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLEEKRKKEEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRRRTAFHPDLCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIVERGKGDGVPERRKFGRMKLLQFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDSDEEWEEEEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDDLKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWSYVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEEEGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTASPLGAS gfi1-chaf1a-2 1158316 n/a 1158323 unspecified role unspecified role bait bait n/a 1158324 unspecified role unspecified role prey prey physical association physical association false false false 1c and d chaf1a-gfi1 1158316 n/a 1158323 unspecified role unspecified role prey prey n/a 1158324 unspecified role unspecified role bait bait physical association physical association false false false 1e gfi1-chaf1a-3 1158317 n/a 1158325 unspecified role unspecified role bait bait n/a 1158326 unspecified role unspecified role prey prey physical association physical association false false false 1g chaf1a-gfi1-1 1158317 n/a 1158325 unspecified role unspecified role prey prey n/a 1158326 unspecified role unspecified role bait bait physical association physical association false false false 1h gfi1-chaf1a 1158318 n/a 1158323 unspecified role unspecified role bait bait n/a 1158324 unspecified role unspecified role prey prey physical association physical association false false false 1a gfi1-chaf1a-1 1158319 n/a 1158323 unspecified role unspecified role bait bait n/a 1158324 unspecified role unspecified role prey prey physical association physical association false false false 1b chaf1a-gfi1-2 1158320 n/a 1158323 unspecified role unspecified role neutral component neutral component n/a 1158324 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2a chaf1a-gfi1-3 1158321 n/a 1158326 unspecified role unspecified role neutral component neutral component n/a 1158325 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2b and c gfi1-chaf1a-4 1158322 n/a 1158326 unspecified role unspecified role prey prey n/a 1158325 unspecified role unspecified role bait bait physical association physical association false false false 1g