MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint verweij-2011-1 LMP1 association with CD63 in endosomes and secretion via exosomes limits constitutive NF-κB activation. human-lcl Human-lymphoblastoid cell line,EBV transformed B lymphocytes lcl lcl-lymphoblastoid cell line,EBV transformed B lymphocytes fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Verweij FJ., van Eijndhoven MA., Hopmans ES., Vendrig T., Wurdinger T., Cahir-McFarland E., Kieff E., Geerts D., van der Kant R., Neefjes J., Middeldorp JM., Pegtel DM. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation verweijf-2011-1 LMP1 association with CD63 in endosomes and secretion via exosomes limits constitutive NF-κB activation. human-lcl Human-lymphoblastoid cell line,EBV transformed B lymphocytes lcl lcl-lymphoblastoid cell line,EBV transformed B lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Verweij FJ., van Eijndhoven MA., Hopmans ES., Vendrig T., Wurdinger T., Cahir-McFarland E., Kieff E., Geerts D., van der Kant R., Neefjes J., Middeldorp JM., Pegtel DM. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation verweijf-2011-2 LMP1 association with CD63 in endosomes and secretion via exosomes limits constitutive NF-κB activation. human-lcl Human-lymphoblastoid cell line,EBV transformed B lymphocytes lcl lcl-lymphoblastoid cell line,EBV transformed B lymphocytes density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Verweij FJ., van Eijndhoven MA., Hopmans ES., Vendrig T., Wurdinger T., Cahir-McFarland E., Kieff E., Geerts D., van der Kant R., Neefjes J., Middeldorp JM., Pegtel DM. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation lmp1_ebvb9 Latent membrane protein 1 LMP1 BNLF1 Protein p63 protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MEHDLERGPPGPRRPPRGPPLSSSLGLALLLLLLALLFWLYIVMSDWTGGALLVLYSFALMLIIIILIIFIFRRDLLCPLGALCILLLMITLLLIALWNLHGQALFLGIVLFIFGCLLVLGIWIYLLEMLWRLGATIWQLLAFFLAFFLDLILLIIALYLQQNWWTLLVDLLWLLLFLAILIWMYYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSNSNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHSPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHGGGDPHLPTLLLGSSGSGGDDDDPHGPVQLSYYD 1E19446E857DB8A3 mint homomint The latent membrane protein has transforming activity cd63_human CD63 antigen Melanoma-associated antigen ME491 Ocular melanoma-associated antigen OMA81H Granulophysin Tetraspanin-30 Lysosomal-associated membrane protein 3 CD63 MLA1 TSPAN30 Lysosome integral membrane protein 1 protein protein human Homo sapiens Human MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM lmp2_ebvb9 Latent membrane protein 2 LMP2 Terminal protein protein protein ebvb9 Epstein-Barr virus (strain B95-8) (HHV-4) Human herpesvirus 4 HHV-4 MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTASVSTVVTATGLALSLLLLAAVASSYAAAQRKLLTPVTVLTAVVTFFAICLTWRIEDPPFNSLLFALLAAAGGLQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLLGAVTVVSMTLLLLAFVLWLSSPGGLGTLGAALLTLAAALALLASLILGTLNLTTMFLLMLLWTLVVLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSILQTNFKSLSSTEFIPNLFCMLLLIVAGILFILAILTEWGSGNRTYGPVFMCLGGLLTMVAGAVWLTVMSNTLLSAWILTAGFLIFLIGFALFGVIRCCRYCCYYCLTLESEERPPTPYRNTV Isoform LMP2A maintains EBV latent infection of B-lymphocyte, by preventing lytic reactivation of the virus in response to surface immunoglobulin (sIg) cross-linking. Acts like a dominant negative inhibitor of the sIg-associated protein tyrosine kinases, LYN and SYK. Also blocks translocation of the B-cell antigen receptor (BCR) into lipid rafts, preventing the subsequent signaling and accelerated internalization of the BCR upon BCR cross-linking. Serves as a molecular scaffold to recruit SYK, LYN and E3 protein-ubiquitin ligases, such as ITCH and NEDD4L, leading to ubiquitination and potential degradation of both tyrosines kinases. Possesses a constitutive signaling activity in non-transformed cells, inducing bypass of normal B lymphocyte developmental checkpoints allowing immunoglobulin-negative cells to colonize peripheral lymphoid organs Isoform LMP2B may be a negative regulator of isoform LMP2A mint homomint hsp71_human Heat shock 70 kDa protein 1A/1B HSPA1A HSPA1 HSPA1B Heat shock 70 kDa protein 1/2 HSX70 protein protein human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD cd63-lmp1 1234501 lmp1_ebvb9 LMP1 1234504 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell cd63_human CD63 1234505 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false homomint mint f1a f4b colocalization occurs also in BJAB cells. cd63-lmp1-1 1234501 lmp1_ebvb9 LMP1 1234504 immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell cd63_human CD63 1234505 immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false f4c homomint mint colocalization occurs also in BJAB cells. lmp1-cd63 1234502 lmp1_ebvb9 LMP1 1234504 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level cd63_human CD63 1234505 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f5a homomint mint hspa1a-lmp1 1234503 lmp2_ebvb9 LMP2 1234506 immunostaining immunostaining unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level lmp1_ebvb9 LMP1 1234504 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level hsp71_human HSP70 1234507 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false f3a homomint mint