MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint bhogaraj-2011-1 Crystal structure of the intraflagellar transport complex 25/27. ecoli Escherichia coli (strain K12) pull down pull down predetermined predetermined participant predetermined Bhogaraju S., Taschner M., Morawetz M., Basquin C., Lorentzen E. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation bhogaraju-2011-1 Crystal structure of the intraflagellar transport complex 25/27. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Bhogaraju S., Taschner M., Morawetz M., Basquin C., Lorentzen E. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation ift25_chlre Intraflagellar transport protein 25 IFT25 FAP232 Flagellar-associated protein 232 CHLREDRAFT_98791 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MKDYAREENGGLVVMASCSDERFPPENMLDGKDNTFWVTTGMFPQEFVLRLESCIRVSKITTLSLNVRKLAVEKCDQDKPDQFEKVFEVELANRGDRLQTEVHQVNIRAKYLKFILLQGHGEFATVNRVSVVGGDDDGGGYDEPGGGYGSMQRQPSMGYGGGGGSAATGFAADPGNAAAGGGGGFEDEF mint ift27_chlre Intraflagellar transport protein 27 IFT27 FAP156 Flagellar-associated protein 156 CHLREDRAFT_129193 protein protein chlre Chlamydomonas reinhardtii Chlamydomonas smithii MVKKEVKPIDITATLRCKVAVVGEATVGKSALISMFTSKGSKFLKDYAMTSGVEVVVAPVTIPDTTVSVELFLLDTAGSDLYKEQISQYWNGVYYAILVFDVSSMESFESCKAWFELLKSARPDRERPLRAVLVANKTDLPPQRHQVRLDMAQDWATTNTLDFFDVSANPPGKDADAPFLSIATTFYRNYEDKVAAFQDACRNY mint fap156-b8lix8 1157750 b8lix8_chlre IFT25 1157752 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell B8LIX8:p.Thr40Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false B8LIX8:p.Val38Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false B8LIX8:p.Thr125Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false a8hn58_chlre IFT27 1157753 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f2b sf5a b8lix8-fap156-1 1157750 a8hn58_chlre IFT27 1157753 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell b8lix8_chlre IFT25 1157752 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell B8LIX8:p.Val38Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false B8LIX8:p.Thr125Glu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false B8LIX8:p.Thr40Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false mint sf5b b8lix8-fap156 1157751 b8lix8_chlre IFT25 1157752 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false a8hn58_chlre IFT27 1157753 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint t1 f1 f2a f5