MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint tanaka-2011-1 Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation tanaka-2011-2 Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation tanaka-2011-4 Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. yeast Saccharomyces cerevisiae Baker's yeast pull down pull down predetermined predetermined participant predetermined Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation tanaka-2011-3 Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation predetermined predetermined participant predetermined Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation tanaka-2011-5 Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. ecoli Escherichia coli (strain K12) pull down pull down predetermined predetermined participant predetermined Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation tanaka-2011-6 Sld7, an Sld3-associated protein required for efficient chromosomal DNA replication in budding yeast. yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Tanaka T., Umemori T., Endo S., Muramatsu S., Kanemaki M., Kamimura Y., Obuse C., Araki H. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation sld7_yeast Mitochondrial morphogenesis protein SLD7 YOR29-11 YOR060C SLD7 Synthetic lethality with DPB11-24 mutation protein 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRKLCTLNFTLSGKQGSLVIRDIQLWSNRPTASKSTSELRGQFIQYVDLAKLPLWVRSTNMNTYRCYSTSATAQAYFKSKLRNANRGIVIELFDKVDQRSQEPAYLIIFRENTELNCFQVDLTMKHEFDGQVTKLKQDIGKTRASVSKEGSIDIIIQQSQQRKIGTKTEVYRNVHINDKRLQFNETLSKLILGGLRLRGISNSITDYQKLYKITFDAAEFTHRDELKRISMGSGEEVSFESLQETVETLLKLFTKS sld3_yeast DNA replication regulator SLD3 SLD3 G2980 YGL113W protein protein yeast Saccharomyces cerevisiae Baker's yeast METWEVIASVKEATKGLDLSLDHPLIIKSEDVPSNILQLLQQKNRRQLKHICMKSRKEYFLLEEYGPGFWVKWPYNYFNGYSLPERRTEVVTTVERERAKRETLKTWDELKFKELLHLWSEEPKGSCKLEKDKDLKLDMNPPDMKGESKINDYYSDPKEYIESKYYDALFSIHTPLAYFVKSNLVRLKNTCRTKYGSDSYKIAYQAMLQKFLLSIVQFKDRHDNRLLLEPFSSPIADEKRKNCLTKFVIQDENKNSSTIADLCVVLKSREIKLQILLLLEIIGLNDLDWNFRDFEKKYKLKLKKRSLNLTKKGLVRRRSKKKTSEKDKGIERITTSLDYCEQLDLYLDRACILDILLSSETPNPDAIEASNGTIQEHKKNILDKSKEASLVGFINYVLIPYFNKKVPHAVEFIIQKLKGPSMRPKRALKKVNDSTNVSSPNTVETYNRLSTSQRASRSSIINSVPSSPALRRVDANLFSRKSIASPTPELLNSRTNSNLNEFLESETRSLKRPSQLGRTKSDLTMNHLQKRQFSVSDLSTTRVPNSSTITLKTPFSHSTINAYKTMNNSFRRVGKRKDINETIRLHERVDSEENVQVQATPAVKKRTVTPNKKAQLQSIIESPLNFKDDDTHEGRKNTSNITSTPTNKPPENSSKRRVRRRLFAPEST 6E59D0DB3C082C28 cdc45_yeast Cell division control protein 45 CDC45 YLR103C L8004.11 SLD4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYYGISQFSEAYNKILRNSSSHSSCQLVIFVSCLNIDALCATKMLSLLFKKQLVQSQIVPIFGYSELRRHYSQLDDNINSLLLVGFGGVIDLEAFLEIDPQEYVIDTDEKSGEQSFRRDIYVLDAHRPWNLDNIFGSQIIQCFDDGTVDDTLGEQKEAYYKLLELDEESGDDELSGDENDNNGGDDEATDADEVTDEDEEDEDETISNKRGNSSIGPNDLSKRKQRKKQIHEYEGVLEEYYSQGTTVVNSISAQIYSLLSAIGETNLSNLWLNILGTTSLDIAYAQVYNRLYPLLQDEVKRLTPSSRNSVKTPDTLTLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLSLWNENGKKRLHKMFARMGIPLSTAQETWLYMDHSIKRELGIIFDKNLDRYGLQDIIRDGFVRTLGYRGSISASEFVEALTALLEVGNSTDKDSVKINNDNNDDTDGEEEEDNSAQKLTNLRKRWVSNFWLSWDALDDRKVELLNRGIQLAQDLQRAIFNTGVAILEKKLIKHLRIYRLCVLQDGPDLDLYRNPLTLLRLGNWLIECCAESEDKQLLPMVLASIDENTDTYLVAGLTPRYPRGLDTIHTKKPILNNFSMAFQQITAETDAKVRIDNFESSIIEIRREDLSPFLEKLTLSGLL 6500DDD62EC4E8EE sld3-sld7 1158482 yo060_yeast SLD7 1158488 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified sld3_yeast SLD3 1158489 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f2c mint sld3-cdc45-2 1158482 sld3_yeast SLD3 1158489 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cdc45_yeast cdc45 1158490 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false f7a mint cdc45-sld3-2 1158482 cdc45_yeast cdc45 1158490 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sld3_yeast SLD3 1158489 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey purified purified direct interaction direct interaction false false false mint sf6a cdc45-sld3-3 1158482 cdc45_yeast cdc45 1158490 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yo060_yeast SLD7 1158488 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey purified purified sld3_yeast SLD3 1158489 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey purified purified physical association physical association false false false mint sf6a sld3-cdc45-3 1158482 yo060_yeast SLD7 1158488 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified sld3_yeast SLD3 1158489 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false cdc45_yeast cdc45 1158490 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified physical association physical association false false false f7a mint sld7-sld3 1158483 yo060_yeast SLD7 1158488 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sld3_yeast SLD3 1158489 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3a mint sld7-sld3-1 1158483 yo060_yeast SLD7 1158488 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sld3_yeast SLD3 1158489 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3a mint cdc45-sld3-4 1158483 sld3_yeast SLD3 1158489 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false cdc45_yeast cdc45 1158490 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a mint sld7-sld3-2 1158484 sld3_yeast SLD3 1158489 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level yo060_yeast SLD7 1158488 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2a mint sld7-sld3-3 1158484 sld3_yeast SLD3 1158489 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yo060_yeast SLD7 1158488 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f2e sf3a sld3-sld7-1 1158485 yo060_yeast SLD7 1158488 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified sld3_yeast SLD3 1158489 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component partially purified partially purified physical association physical association false false false f2d mint sld3-sld7-2 1158486 yo060_yeast SLD7 1158488 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell sld3_yeast SLD3 1158489 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2b mint sld3-sld7-3 1158487 sld3_yeast SLD3 1158489 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yo060_yeast SLD7 1158488 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint f2f sf3b