UniProt UniProt http://www.uniprot.org lobito-2011-5 Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation lobito-2011-1 Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation lobito-2011-2 Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. in vitro In vitro array technology array technology tag fluorescence tag visualisation by fluorescence tag fluorescence Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation lobito-2011-3 Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs tag fluorescence tag visualisation by fluorescence tag fluorescence Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation lobito-2011-4 Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1. in vitro In vitro competition binding competition binding tag visualisation tag visualisation Lobito AA., Ramani SR., Tom I., Bazan JF., Luis E., Fairbrother WJ., Ouyang W., Gonzalez LC. gonzalez.lino@gene.com J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation igfr1_human IGF-like family receptor 1 TMEM149 Transmembrane protein 149 IGFLR1 U2AF1L4 U2 small nuclear RNA auxiliary factor 1-like 4 protein protein human Homo sapiens Human MGPGRCLLTALLLLALAPPPEASQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLPLVVLVLLLTLAVIAILLFILLWHLCWPKEKADPYPYPGLVCGVPNTHTPSSSHLSSPGALETGDTWKEASLLPLLSRELSSLASQPLSRLLDELEVLEELIVLLDPEPGPGGGMAHGTTRHLAARYGLPAAWSTFAYSLRPSRSPLRALIEMVVAREPSASLGQLGTHLAQLGRADALRVLSKLGSSGVCWA igfl1_human Insulin growth factor-like family member 1 IGFL1 UNQ644/PRO1274 protein protein human Homo sapiens Human MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS igfl2_human Insulin growth factor-like family member 2 IGFL2 UNQ645/PRO1275 protein protein human Homo sapiens Human MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPCTFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP igfl3_human Insulin growth factor-like family member 3 IGFL3 UNQ483/PRO982 protein protein human Homo sapiens Human MRPRCCILALVCWITVFLLQCSKGTTDAPVGSGLWLCQPTPRCGNKIYNPSEQCCYDDAILSLKETRRCGSTCTFWPCFELCCPESFGPQQKFLVKLRVLGMKSQCHLSPISRSCTRNRRHVLYP igfl_mouse Insulin growth factor-like family member mIgfl Igfl Gm580 Igfl3 protein protein mouse Mus musculus Mouse MKIRNACAVLIEVLLFILEGVTGARKISTFSGPGSWPCNPKCDGRTYNPSEECCVHDTILPFKRINLCGPSCTYRPCFELCCPESYSPKKKFIVKLKVHGERSHCSSSPISRNCKSNKIFHGEDIEDNQLSLRKKSGDQP igfr1_mouse IGF-like family receptor 1 Igflr1 Tmem149 Transmembrane protein 149 protein protein mouse Mus musculus Mouse MGPSWLLWTVAVAVLLLTRAASMEASSFCGHLEYWNSDKRCCSRCLQRFGPPACPDHEFTENCGLNDFGDTVAHPFKKCSPGYCNPNGTELCSQCSSGAAAAPAHVESPGRTHKQCRKKPVPPKDVCPLKPEDAGASSSPGRWSLGQTTKNEVSSRPGFVSASVLPLAVLPLLLVLLLILAVVLLSLFKRKVRSRPGSSSAFGDPSTSLHYWPCPGTLEVLESRNRGKANLLQLSSWELQGLASQPLSLLLDELEVLEELIMLLDPEPGPSGSTAYGTTRHLAARYGLPATWSTFAYSLRPSRSPLRALIEMVVAREPSATLGQFGTYLAQLGRTDALQVLSKLG tm149-igfl1-1 1136131 n/a 1136136 unspecified role unspecified role bait bait fc-igg region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1136137 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false fig 4c tm149-igfl2 1136131 n/a 1136138 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1136136 unspecified role unspecified role bait bait fc-igg region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false 4E Low response and fast dissociation tm149-igfl3 1136131 n/a 1136136 unspecified role unspecified role bait bait fc-igg region fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false fc-igg fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1136139 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false 4E tm149-igfl-1 1136131 n/a 1136140 unspecified role unspecified role prey prey crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1136141 unspecified role unspecified role bait bait crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false 5 igfl-igfl-2 1136132 n/a 1136140 unspecified role unspecified role neutral component neutral component flag_tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false fig 1 igfl1-igfl1-1 1136132 n/a 1136137 unspecified role unspecified role neutral component neutral component flag_tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 physical association physical association false false false fig 1 igfl1-tm149 1136133 n/a 1136136 unspecified role unspecified role prey prey n/a 1136137 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false fc-igg region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig3a tmem149-igfl1 1136133 n/a 1136136 unspecified role unspecified role bait bait n/a 1136137 unspecified role unspecified role prey prey region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false fig3b igfl1-tmem149-2 1136134 n/a 1136137 unspecified role unspecified role unspecified role unspecified role n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1136136 unspecified role unspecified role unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization false false false fig 4 igfl-tmem149-2 1136134 n/a 1136140 unspecified role unspecified role unspecified role unspecified role n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1136141 unspecified role unspecified role unspecified role unspecified role region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization false false false 5 igfl1-tmem149-1 1136135 n/a 1136137 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1136136 unspecified role unspecified role neutral component neutral component crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association false false false 1136135 fig 4c igfl-tmem149-1 1136135 n/a 1136140 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. n/a 1136141 unspecified role unspecified role neutral component neutral component human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 1136135 fig 5