IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ shin-2011-1 PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. shin-2011-5 PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. shin-2011-6 PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. shin-2011-8 PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. human-brain Homo sapiens brain brain Brain [cerebrum] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. shin-2011-3 PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. human-brain Homo sapiens brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. shin-2011-4 PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. shin-2011-2 PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. shin-2011-7 PARIS (ZNF746) Repression of PGC-1α Contributes to Neurodegeneration in Parkinson's Disease. mouse-brain Mus musculus brain brain Brain [cerebrum] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Shin JH., Ko HS., Kang H., Lee Y., Lee YI., Pletinkova O., Troconso JC., Dawson VL., Dawson TM. Parkinsons - Interactions investigated in the context of Parkinsons disease Source of parkin taken from manufacturer's website. tdawson@jhmi.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. zn746_human Zinc finger protein 746 PARIS ZNF746 Parkin-interacting substrate protein protein human Homo sapiens Human MAEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCNWRRPGPKIPDVPVDPSPGSGPPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVHSNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTEDVKIVIKTEVQEEEVVATPVHPTDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPARPERDMGELSPAVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGAPDGSGPGTGGGGSGSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQPLPTPPAPPDPFKSPASKGPLASTDLVTDWTCGLSVLGPTDGGDM prkn_human E3 ubiquitin-protein ligase parkin PRKN PARK2 Parkin RBR E3 ubiquitin-protein ligase Parkinson juvenile disease protein 2 protein protein human Homo sapiens Human MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV irs3_ppargc1a_human_dna IRS3 region of PPARGC1A gene ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) GCCACTTGCTTGTTTTGGAAGGAAAAT irs1_ppargcia_human_dna irs1 region of PPARGC1a gene ss dna single stranded deoxyribonucleic acid ss DNA ss dna human Homo sapiens Human AGTGTGTTGGTATTTTTCCCTCAGTTC irs2_ppargc1a_human_dna IRS2 region of PPARGC1A gene ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) ACATACAGGCTATTTTGTTGATTAAAC pckcg_human_gene Phosphoenolpyruvate carboxykinase, cytosolic [GTP] gene gene gene human Homo sapiens Human g6pc_human_gene Glucose-6-phosphatase gene gene gene human Homo sapiens Human prgc1_human_gene Peroxisome proliferator-activated receptor gamma coactivator 1-alpha gene gene gene human Homo sapiens Human prkn_mouse E3 ubiquitin-protein ligase parkin Prkn Park2 Parkin RBR E3 ubiquitin-protein ligase protein protein mouse Mus musculus Mouse MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV zn746_mouse Zinc finger protein 746 Znf746 Zfp746 protein protein mouse Mus musculus Mouse MAEAAAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFSNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGEVPKEWGKLEDWQKELYKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCTWRRTGPKVPEVPVDPSPGSGAPVPAPDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVHSNFSTTIPPTSWQADLPPHHPSSACSDGTLKLNTAASTEADVKIVIKTEVQEEEVVATPVHPTDLEAHGTLFAPGQATRFFPSPVQEGAWESQGSSFPSQDPVLGLREPTRPERDIGELSPAIAQEEAPAGDWLFGGVRWGWNFRCKPPVGLNPRTVPEGLPFSSPDNGEAILDPSQAPRPFNDPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGLSDGAATGAASTTTGGGGGGSGGGGGSSGGGSSARDSSALRCGECGRCFTRPAHLIRHRMLHTGERPFPCTECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHPAVAKAPAHGQPLPPLPAPPDPFKSPAAKGPMASTDLVTDWTCGLSVLGPSDGGGDL prgc1_mouse_gene Peroxisome proliferator-activated receptor gamma coactivator 1-alpha gene gene gene mouse Mus musculus Mouse zn746-park2 1131865 n/a 1131873 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1131874 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false O60260:p.Cys431Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false O60260:p.His257Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figs. 2A, 2C, Supp. Fig. 2B park2-zn746-3 1131865 n/a 1131874 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ring finger 1 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false ring finger 2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range false n/a 1131873 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Supp. Fig. 2C zn746-park2-4 1131865 n/a 1131873 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1131874 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false r1-ibr-r2 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range certain certain sequence position certain false physical association physical association false false false Supp. Fig. 2D irs3-znf746 1131866 n/a 1131875 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131873 unspecified role unspecified role prey prey direct interaction direct interaction false false false irs1-znf746 1131866 n/a 1131876 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1131873 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Supp. Fig. 4F irs2-znf746 1131866 n/a 1131873 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 1131877 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false Supp. Fig. 4F znf746-pckcg 1131867 n/a 1131873 unspecified role unspecified role bait bait n/a 1131878 unspecified role unspecified role prey prey association association false false false ZNF746 binds to the promotor region of the gene Supp. Fig. 4J znf746-g6pc 1131867 n/a 1131879 unspecified role unspecified role prey prey n/a 1131873 unspecified role unspecified role bait bait association association false false false ZNF746 binds to the promotor region of the gene Supp. Fig. 4J znf746-prgc2 1131867 n/a 1131880 unspecified role unspecified role prey prey n/a 1131873 unspecified role unspecified role bait bait association association false false false ZNF746 binds to the promotor region of the gene Fig. 5D znf746-pckcg-1 1131868 n/a 1131878 unspecified role unspecified role prey prey n/a 1131873 unspecified role unspecified role bait bait association association false false false ZNF746 binds to the promotor region of the gene Supp. Fig. 4K Observed at equal levels in both control and samples from Parkinson Disease patients. znf746-g6pc-1 1131868 n/a 1131879 unspecified role unspecified role prey prey n/a 1131873 unspecified role unspecified role bait bait association association false false false ZNF746 binds to the promotor region of the gene Supp. Fig. 4J Observed at equal levels in both control and samples from Parkinson Disease patients. znf746-prgc2-2 1131868 n/a 1131873 unspecified role unspecified role bait bait n/a 1131880 unspecified role unspecified role prey prey association association false false false ZNF746 binds to the promotor region of the gene Fig. 5D There is enhanced ZNF746 occupancy of endogenous PPARGC1 in PD striatum compared to control zn746-park2-2 1131869 n/a 1131874 unspecified role unspecified role prey prey n/a 1131873 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2D park2-zn746 1131869 n/a 1131874 unspecified role unspecified role bait bait n/a 1131873 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2D zn746-park2-3 1131870 n/a 1131881 unspecified role unspecified role prey prey n/a 1131882 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2E, Supp. Fig. 2A park2-zn746-1 1131870 n/a 1131881 unspecified role unspecified role bait bait n/a 1131882 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2E, Supp. Fig. 2A zn746-park2-1 1131871 n/a 1131873 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1131874 unspecified role unspecified role prey prey n-terminal region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2B znf746-prgc2-1 1131872 n/a 1131882 unspecified role unspecified role bait bait n/a 1131883 unspecified role unspecified role prey prey association association false false false Fig. 5E ZNF746 binds to the promotor of the gene.