MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint poppenberge-2011-1 CESTA, a positive regulator of brassinosteroid biosynthesis. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Poppenberger B., Rozhon W., Khan M., Husar S., Adam G., Luschnig C., Fujioka S., Sieberer T. brigitte.poppenberger@univie.ac.at EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation poppenbe-2011-2 CESTA, a positive regulator of brassinosteroid biosynthesis. arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Poppenberger B., Rozhon W., Khan M., Husar S., Adam G., Luschnig C., Fujioka S., Sieberer T. brigitte.poppenberger@univie.ac.at EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation poppenbe-2011-1 CESTA, a positive regulator of brassinosteroid biosynthesis. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Poppenberger B., Rozhon W., Khan M., Husar S., Adam G., Luschnig C., Fujioka S., Sieberer T. brigitte.poppenberger@univie.ac.at EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation poppenbe-2011-3 CESTA, a positive regulator of brassinosteroid biosynthesis. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Poppenberger B., Rozhon W., Khan M., Husar S., Adam G., Luschnig C., Fujioka S., Sieberer T. brigitte.poppenberger@univie.ac.at EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation bh075_arath Transcription factor bHLH75 BHLH75 EN78 Basic helix-loop-helix protein 75 Transcription factor EN 78 bHLH transcription factor bHLH075 F4F7.28 At1g25330 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARFEPYNYNNGHDPFFAHINQNPELINLDLPASTPSSFMLFSNGALVDANHNNSHFFPNLLHGNTRRKGNKEESGSKRRRKRSEEEEAMNGDETQKPKDVVHVRAKRGQATDSHSLAERVRREKINERLKCLQDLVPGCYKAMGMAVMLDVIIDYVRSLQNQIEFLSMKLSAASACYDLNSLDIEPTDIFQGGNIHSAAEMERILRESVGTQPPNFSSTLPF mint bee1_arath Transcription factor BEE 1 BEE1 BHLH44 EN77 Basic helix-loop-helix protein 44 Protein Brassinosteroid enhanced expression 1 Transcription factor EN 77 bHLH transcription factor bHLH044 F15H18.11 F15H18.16 At1g18400 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANFENLSSDFQTIAMDIYSSITQAADLNNNNSNLHFQTFHPSSTSLESLFLHHHQQQLLHFPGNSPDSSNNFSSTSSFLHSDHNIVDETKKRKALLPTLSSSETSGVSDNTNVIATETGSLRRGKRLKKKKEEEDEKEREVVHVRARRGQATDSHSLAERVRRGKINERLRCLQDMVPGCYKAMGMATMLDEIINYVQSLQNQVEFLSMKLTAASSFYDFNSETDAVDSMQRAKARETVEMGRQTRDGSPVFHLSTWSL bee3_arath Transcription factor BEE 3 BEE3 BHLH50 EN76 Basic helix-loop-helix protein 50 Protein Brassinosteroid enhanced expression 3 Transcription factor EN 76 bHLH transcription factor bHLH050 F25P22.25 At1g73830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANLSSDFQTFTMDDPIRQLAELSNTLHHFQTFPPPFSSSLDSLFFHNQFPDHFPGKSLENNFHQGIFFPSNIQNNEESSSQFDTKKRKSLMEAVSTSENSVSDQTLSTSSAQVSINGNISTKNNSSRRGKRSKNREEEKEREVVHVRARRGQATDSHSIAERVRRGKINERLKCLQDIVPGCYKTMGMATMLDEIINYVQSLQNQVEFLSMKLTAASSYYDFNSETDAVESMQKAKAREAVEMGQGRDGSSVFHSSSWTL mint ksg7_arath Shaggy-related protein kinase eta ASK7 BIN2 DWF12 UCU1 ASK-eta Protein BRASSINOSTEROID INSENSITIVE 2 Protein ULTRACURVATA 1 F28A21.120 At4g18710 SK21 Shaggy-related protein kinase 21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFSTTSKDELFLNLVMEYVPESLYRVLKHYSSANQRMPLVYVKLYMYQIFRGLAYIHNVAGVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSGT bhlh75-bee1 1130642 bh075_arath CES 1130646 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bee1_arath BEE1 1130647 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint SF2D bhlh75-bee3 1130642 bh075_arath CES 1130646 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bee3_arath BEE3 1130648 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint SF2D bhlh75-bhlh75 1130642 bh075_arath CES 1130646 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bh075_arath CES 1130646 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint SF2D bee1-bhlh75-1 1130643 bh075_arath CES 1130646 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bee1_arath BEE1 1130647 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false F8B mint bee3-bhlh75 1130643 bh075_arath CES 1130646 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bee3_arath BEE3 1130648 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false SF2C mint bee1-bhlh75 1130644 bh075_arath CES 1130646 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bee1_arath BEE1 1130647 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F8C mint ask7-bhlh75 1130645 bh075_arath CES 1130646 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ksg7_arath BIN2 1130649 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false F8D mint