MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint szklarczyk-2011-1 NDUFB7 and NDUFA8 are located at the intermembrane surface of complex I. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bn-page blue native page bn-page predetermined predetermined participant predetermined Szklarczyk R., Wanschers BF., Nabuurs SB., Nouws J., Nijtmans LG., Huynen MA. FEBS Lett. (0014-5793) 2011 ndua8_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 NDUFA8 NADH-ubiquinone oxidoreductase 19 kDa subunit Complex I-19kD Complex I-PGIV protein protein human Homo sapiens Human MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK ndus3_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial NDUFS3 NADH-ubiquinone oxidoreductase 30 kDa subunit Complex I-30kD protein protein human Homo sapiens Human MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK C058D62779BEF17B ndufa8-ndufs3 1014765 ndua8_human NDUFA8 1014766 mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ndus3_human NDUFS3 1014767 mudpit multidimensional protein identification technology mudpit unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false f5 homomint mint