IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ stefan-2011-2 Osh proteins regulate phosphoinositide metabolism at ER-plasma membrane contact sites. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay anti tag western anti tag western blot anti tag western Stefan CJ., Manford AG., Baird D., Yamada-Hanff J., Mao Y., Emr SD. sde26@cornell.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation stefan-2011-3 Osh proteins regulate phosphoinositide metabolism at ER-plasma membrane contact sites. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Stefan CJ., Manford AG., Baird D., Yamada-Hanff J., Mao Y., Emr SD. Dithiobis[succinimidyl propionate] and Dimethyl 3,3´-dithiobispropionimidate used as cross linking agents. Complexes then immunoprecipitated using anti-HA Abs. sde26@cornell.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation stefan-2011-1 Osh proteins regulate phosphoinositide metabolism at ER-plasma membrane contact sites. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Stefan CJ., Manford AG., Baird D., Yamada-Hanff J., Mao Y., Emr SD. sde26@cornell.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation stefan-2011-4 Osh proteins regulate phosphoinositide metabolism at ER-plasma membrane contact sites. in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Stefan CJ., Manford AG., Baird D., Yamada-Hanff J., Mao Y., Emr SD. Protein binding alters changes in spectral properties of fluorexcent dye (e.g., emission wavelength maximum, termed “blue shift,” and intensity) when moved from an aqueous environment to a more hydrophobic environment. Assay performed in presence of liposomes (presence of liposomes (PC:PS:PI4P, 3:1:1, 0.1 mM lipid total) sde26@cornell.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation kes1_yeast Oxysterol-binding protein homolog 4 KES1 OSH4 Protein KES1 LPI3C P2614 YPL145C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQYASSSSWTSFLKSIASFNGDLSSLSAPPFILSPISLTEFSQYWAEHPELFLEPSFINDDNYKEHCLIDPEVESPELARMLAVTKWFISTLKSQYCSRNESLGSEKKPLNPFLGELFVGKWENKEHPEFGETVLLSEQVSHHPPVTAFSIFNDKNKVKLQGYNQIKASFTKSLMLTVKQFGHTMLDIKDESYLVTPPPLHIEGILVASPFVELEGKSYIQSSTGLLCVIEFSGRGYFSGKKNSFKARIYKDSKDSKDKEKALYTISGQWSGSSKIIKANKKEESRLFYDAARIPAEHLNVKPLEEQHPLESRKAWYDVAGAIKLGDFNLIAKTKTELEETQRELRKEEEAKGISWQRRWFKDFDYSVTPEEGALVPEKDDTFLKLASALNLSTKNAPSGTLVGDKEDRKEDLSSIHWRFQRELWDEEKEIVL pi3p 1-phosphatidyl-1D-myo-inositol 3-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pi4p 1-phosphatidyl-1D-myo-inositol 4-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 4,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sac1_yeast Phosphatidylinositol-3-phosphatase SAC1 SAC1 RSD1 YKL212W Recessive suppressor of secretory defect Phosphatidylinositol-4-phosphate phosphatase protein protein yeast Saccharomyces cerevisiae Baker's yeast MTGPIVYVQNADGIFFKLAEGKGTNDAVIHLANQDQGVRVLGAEEFPVQGEVVKIASLMGFIKLKLNRYAIIANTVEETGRFNGHVFYRVLQHSIVSTKFNSRIDSEEAEYIKLLELHLKNSTFYFSYTYDLTNSLQRNEKVGPAASWKTADERFFWNHYLTEDLRNFAHQDPRIDSFIQPVIYGYAKTVDAVLNATPIVLGLITRRSIFRAGTRYFRRGVDKDGNVGNFNETEQILLAENPESEKIHVFSFLQTRGSVPIYWAEINNLKYKPNLVLGENSLDATKKHFDQQKELYGDNYLVNLVNQKGHELPVKEGYESVVHALNDPKIHYVYFDFHHECRKMQWHRVKLLIDHLEKLGLSNEDFFHKVIDSNGNTVEIVNEQHSVVRTNCMDCLDRTNVVQSVLAQWVLQKEFESADVVATGSTWEDNAPLLTSYQNLWADNADAVSVAYSGTGALKTDFTRTGKRTRLGAFNDFLNSASRYYQNNWTDGPRQDSYDLFLGGFRPHTASIKSPFPDRRPVYIQLIPMIICAALTVLGATIFFPKDRFTSSKNLLYFAGASIVLALSTKFMFKNGIQFVNWPKLVDVGFLVVHQTHDKEQQFKGLKYAQSPKFSKPDPLKRD 73DB1FA163BC17AE osh3_yeast Oxysterol-binding protein homolog 3 YHR073W OSH3 protein protein yeast Saccharomyces cerevisiae Baker's yeast METIDIQNRSFVVRWVKCGRGDVINYQIKPLKKSIEVGIYKKLKSSVDDHASAVHIAPDTKTLLDYTTKSLLHKGSSSNIEEHHRRSSQHSHSSSNGSDNKRKERSYSSLSISGIQQQSQEIPLREKLSASGFTLVKRVGNVSGNTMVQGDLEVKDTDYYYAFILDNSSSKNAKKKILFNASVINGDNQSMISTRSTPPARPTALSRTSTQQDMLFRVGQGRYLQGYLLKKRRKRLQGFKKRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTKENWQSWVDALQTCFDDQFEDKDTSTLEENPDILDDDKEVINKSSPQDHDHLTPTATTKSALSHRQHTQKDMDDIYVPLPSESYATFSMNLRLIQQRLEQCKKDSLSYKPTTLHQRSEGLNGTHSSSSVFTNNRVSSFNHSSSGMTSSDSLASEEVPSNKTYIEHALYNQLADLEVFVSRFVTQGEVLFKDHQILCKKAKDTRVSLTSYLSENDEFFDAEEEISRGVIILPDTEDDINNIVEETPLLGKSDQNEFTKEVQLSGSEQIASSSVESYTTNDENHSRKHLKNRHKNRRRGHPHHQKTKSAQSSTETFTSKDLFALSYPKSVTRRNDIPEAAASPPSLLSFLRKNVGKDLSSIAMPVTSNEPISILQLISETFEYAPLLTKATQRPDPITFVSAFAISFLSIYRDKTRTLRKPFNPLLAETFELIREDMGFRLISEKVSHRPPVFAFFAEHLDWECSYTVTPSQKFWGKSIELNNEGILRLKFKTTGELFEWTQPTTILKNLIAGERYMEPVNEFEVHSSKGDKSHILFDKAGMFSGRSEGFKVSIIPPPSSNRKKETLAGKWTQSLANETTHETIWEVGDLVSNPKKKYGFTKFTANLNEITEIEKGNLPPTDSRLRPDIRAYEEGNVDKAEEWKLKLEQLQRERRNKGQDVEPKYFEKVSKNEWKYITGPKSYWERRKKHDWSDISQLW B1AD1210EFFB9AFE scs2_yeast Vesicle-associated membrane protein-associated protein SCS2 YER120W SCS2 VAP homolog 1 Choline sensitivity suppressor protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAVEISPDVLVYKSPLTEQSTEYASISNNSDQTIAFKVKTTAPKFYCVRPNAAVVAPGETIQVQVIFLGLTEEPAADFKCRDKFLVITLPSPYDLNGKAVADVWSDLEAEFKQQAISKKIKVKYLISPDVHPAQNQNIQENKETVEPVVQDSEPKEVPAVVNEKEVPAEPETQPPVQVKKEEVPPVVQKTVPHENEKQTSNSTPAPQNQIKEAATVPAENESSSMGIFILVALLILVLGWFYR 45390E24E31D392E 1_phosphatidy-kes1-1 1131055 n/a 1131059 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35844:p.[Arg236Glu;Lys242_Lys243delinsGluGlu] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n/a 1131060 unspecified role unspecified role bait bait direct interaction direct interaction false false false Supp. Fig. 6B pi4p-kes1 1131055 n/a 1131061 unspecified role unspecified role bait bait n/a 1131059 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P35844:p.[Arg236Glu;Lys242_Lys243delinsGluGlu] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Supp. Fig. 6B 1_phosphatidy-kes1-1 1131055 n/a 1131059 unspecified role unspecified role prey prey n/a 1131062 unspecified role unspecified role bait bait direct interaction direct interaction false false false Supp. Fig. 6B osh3-sac1 1131056 n/a 1131063 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131064 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 7A osh7-sac1-3 1131056 n/a 1131063 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 7A osh3-scs2 1131057 n/a 1131064 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1131065 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig. 3B osh3-sac1-1 1131058 n/a 1131064 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1131063 unspecified role unspecified role neutral component neutral component cys341nbd (4-nitrobenzo-2-oxa-1,3-diazole) fluorescent dye fluorescent dye label fluorescent dye certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P32368:p.[Cys392Ser;Cys395Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. 7B