MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint forzani-2011-4 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Forzani C., Carreri A., de la Fuente van Bentem S., Lecourieux D., Lecourieux F., Hirt H. FEBS J. (1742-464X) 2011 forzani-2011-1 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Forzani C., Carreri A., de la Fuente van Bentem S., Lecourieux D., Lecourieux F., Hirt H. FEBS J. (1742-464X) 2011 forzani-2011-2 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Forzani C., Carreri A., de la Fuente van Bentem S., Lecourieux D., Lecourieux F., Hirt H. FEBS J. (1742-464X) 2011 forzani-2011-3 The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Forzani C., Carreri A., de la Fuente van Bentem S., Lecourieux D., Lecourieux F., Hirt H. FEBS J. (1742-464X) 2011 oxi1_arath Serine/threonine-protein kinase OXI1 AGC serine/threonine-protein kinase subfamily 2 member 1 OXI1 AGC2-1 Protein OXIDATIVE SIGNAL-INDUCIBLE 1 MJL12.21 At3g25250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLEGDEKQSRALDFNRLEVLSLLGRGAKGVVFLVRDDDAKLLALKVILKEAIEKKKKGRESEDDEYKRVSFEQGVLSRFDHPLFPSLHGVLATDKVIGYAIDYCPGQNLNSLRKMQSESMFSDEIIRFYAAELVLALDYLHNQGIVYRDLKPDNVMIQENGHLMLIDFDLSTNLAPRTPQPSPSLSKPSPTMKRKKRLFRFTSFCNSGISPQESISVHSSSTLAVSDSSGEKSNSFVGTEEYVAPEVISGDGHDFAVDWWSLGVVLYEMLYGATPFRGSNRKETFYRILSKPPNLTGETTSLRDLIRRLLEKDPSRRINVEEIKGHDFFRGVDWEKVILVSRPPYIPAPDDGGDKGTDVNTKMDVENIVQEIFAARQEREKQSGDNNKNANMKIKDNTSGEWVKGLNNNHDLESDNNFLVF mint y2706_arath Probable receptor-like protein kinase At2g47060 F14M4.11 At2g47060 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSCFGCCGEDDDMHKTADYGGRHNQAKHFPPGNDARHHQASETAQKGPPVVKLQPIEVPIIPFSELKEATDDFGSNSLIGEGSYGRVYYGVLNNDLPSAIKKLDSNKQPDNEFLAQVSMVSRLKHDNFVQLLGYCVDGNSRILSYEFANNGSLHDILHGRKGVKGAQPGPVLSWYQRVKIAVGAARGLEYLHEKANPHIIHRDIKSSNVLLFEDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHRLPRGQQSLVTWATPKLSEDKVKQCVDARLGGDYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNARAVAPGEGVH mpk3_arath Mitogen-activated protein kinase 3 MPK3 At3g45640 T6D9.4 F9K21.220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNTGGGQYTDFPAVETHGGQFISYDIFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDTETNELVAMKKIANAFDNHMDAKRTLREIKLLRHLDHENIIAIRDVVPPPLRRQFSDVYISTELMDTDLHQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANIIHRDLKPSNLLLNANCDLKICDFGLARPTSENDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRKPLFPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNFPRQPLAKLFSHVNPMAIDLVDRMLTFDPNRRITVEQALNHQYLAKLHDPNDEPICQKPFSFEFEQQPLDEEQIKEMIYQEAIALNPTYG mpk6_arath Mitogen-activated protein kinase 6 MPK6 At2g43790 F18O19.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFENHALSEEQMKELIYREALAFNPEYQQ pti11_arath PTI1-like tyrosine-protein kinase 1 PTI11 F12K11.1 F4H5.21 At1g06700 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRKWICCTCQIEDSNEEQQLKSSQQQSDANHKNSKPAPVAKHEVKKEALPIEVPPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKPPAAAPAPES mint o80719-3 Probable receptor-like protein kinase At2g47060 F14M4.11 At2g47060 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSCFGCCGEDDDMHKTADYGGRHNQAKHFPPGNDARHHQASETAQKGPPVVKLQPIEVPIIPFSELKEATDDFGSNSLIGEGSYGRVYYGVLNNDLPSAIKKLDSNKQPDNEFLAQVSMVSRLKHDNFVQLLGYCVDGNSRILSYEFANNGSLHDILHGRKGVKGAQPGPVLSWYQRVKIAVGAARGLEYLHEKANPHIIHRDIKSSNVLLFEDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLNAKSDVYSFGVVLLELLTGRKPVDHRLPRGQQSLVTWATPKLSEDKVKQCVDARLGGDYPPKAVAKVRNQTFHNLRLCLRFRLHSLFLTSSYGDDDSQLAAVAALCVQYEADFRPNMSIVVKALQPLLNARAVAPGEGVH Derived from EST data. No experimental confirmation available. mint q9sv69_arath F25G13.90 F25G13_90 At4g13000 At4g13000/F25G13_90 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNHLLPPENKIPTLNFDHLEIFSALGRGSKGVVFLVKADNKWLALKVILRESIESKKAKDEYKRISFEQGVLSRFDHPLFPRLHGVISTDKVIGYAIDYCPGRDLNSLRKKQSEEMFSDEIIRFYAAELVIALEYLHNQGIVYRDLKPDNVMIQENGHLMLVDFDLSTNLPPRTPQSSFSSSPRLSTATKKERSIFAFSGLCNSGISPDDSVSRSSESEFSGEKSNSFVGTEEYVAPEVITGSGHDFAVDWWSLGVVLYEMLYGATPFRGSNRKETFLKILTEPPSLVGETTSLRDLVRKLLEKDPSRRINVEGIKGHDFFKGLDWDLVLKVSRPPYIPAPENYEISKIDVEKFVHEIFTKCEHNGNFIVF unc_arath Serine/threonine-protein kinase UCN UNC AGC serine/threonine-protein kinase subfamily 2 member 3 AGC2-3 Protein UNICORN F11M15.3 F23H24.1 At1g51170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress METRPSSSSSLSPATNLNLDRLKVLKLLGKGATGTVFLVHDSVSDSSVSSPFALKLVDKSSASSLRRARWEIQILRRLSDDTNPNPFLPKLLASSESSEFIAWALPYCSGGDLNVLRQRQNDGVFSSSVIKFYLAEIVCALDHLHTMGIAYRDLKPENILLQESGHVTLTDFDLSCSLNKPTRPEFYHLSDPEPDPNPESNLSHNKKSLRIFRQKKKKTKSARVNPITRRRLSFSGGERSNSFVGTDEYISPEVIRGDGHDFAVDWWALGVLTYEMMYGETPFKGRNKKETFRNVLVKEPEFAGKPSDLTDLIRRLLVKDPTKRFGFWRGAAEIKEHAFFKGVRWELLTEVLRPPFIPLRDDGDLTGKVTEESGFGIKEYFEKLKTPPLPLPHECSENNPFVDF oxi1-y2706-2 1012866 oxi1_arath OXI1 1012870 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9LSF1:p.Lys45Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false y2706_arath PTI1-4 1012871 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false f4a mint oxi1-3 1012866 oxi1_arath OXI1 1012870 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra self self self self purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false true false f4a mint true mpk3-oxi1 1012866 oxi1_arath OXI1 1012870 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mpk3_arath MPK3 1012872 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false f5b mint mpk3-y2706-1 1012866 y2706_arath PTI1-4 1012871 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mpk3_arath MPK3 1012872 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false f5b mint mpk6-y2706-2 1012866 y2706_arath PTI1-4 1012871 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mpk6_arath MPK6 1012873 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false f5b mint mpk6-oxi1 1012866 oxi1_arath OXI1 1012870 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mpk6_arath MPK6 1012873 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false phosphorylation phosphorylation reaction phosphorylation false false false f5b mint oxi1-pti11 1012867 q8h1g6_arath PTI1-1 1012874 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false oxi1_arath OXI1 1012870 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1a mint oxi1-o80719_3 1012867 o80719-3 PTI1-4 1012875 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false oxi1_arath OXI1 1012870 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1a mint y2706-at4g13000_f25g 1012867 q9sv69_arath AGC2-2 1012876 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false y2706_arath PTI1-4 1012871 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1B mint y2706-f11m15_3 1012867 y2706_arath PTI1-4 1012871 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q9syb9_arath AGC2-3 1012877 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1B mint oxi1-y2706 1012868 oxi1_arath OXI1 1012870 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false y2706_arath PTI1-4 1012871 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false mint f1c f6b y2706-oxi1 1012868 oxi1_arath OXI1 1012870 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false y2706_arath PTI1-4 1012871 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false mint f1c f6a mpk3-y2706 1012868 mpk3_arath MPK3 1012872 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false y2706_arath PTI1-4 1012871 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f6b mint mpk6-y2706 1012868 y2706_arath PTI1-4 1012871 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mpk6_arath MPK6 1012873 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f6b mint oxi1-y2706-1 1012869 oxi1_arath OXI1 1012870 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false y2706_arath PTI1-4 1012871 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2 mint mpk6-y2706-1 1012869 mpk6_arath MPK6 1012873 predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level y2706_arath PTI1-4 1012871 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f6c mint