Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com www.molecularconnections.com tapia-2011-3 LIM kinase1 modulates function of membrane type matrix metalloproteinase 1: implication in invasion of prostate cancer cells. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tapia T., Ottman R., Chakrabarti R. Cancer - Interactions investigated in the context of cancer BPH1 cells were stably transfected with constitutively active (phosphomimic) mutant of human LIMK1 with Flag tag at C-terminus rchak@mail.ucf.edu. rchak@mail.ucf.edu Mol. Cancer (null) 2011 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd tapia-2011-1 LIM kinase1 modulates function of membrane type matrix metalloproteinase 1: implication in invasion of prostate cancer cells. human-bph1 Human BPH1 cells bph1 BPH-1 benign hyperplastic prostatic epithelial cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Tapia T., Ottman R., Chakrabarti R. Cancer - Interactions investigated in the context of cancer BPH1 cells were stably transfected with constitutively active (phosphomimic) mutant of human LIMK1 with Flag tag at C-terminus rchak@mail.ucf.edu. rchak@mail.ucf.edu Mol. Cancer (null) 2011 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd tapia-2011-2 LIM kinase1 modulates function of membrane type matrix metalloproteinase 1: implication in invasion of prostate cancer cells. human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Tapia T., Ottman R., Chakrabarti R. Cancer - Interactions investigated in the context of cancer BPH1 cells were stably transfected with constitutively active (phosphomimic) mutant of human LIMK1 with Flag tag at C-terminus rchak@mail.ucf.edu. rchak@mail.ucf.edu Mol. Cancer (null) 2011 Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd mmp14_human Matrix metalloproteinase-14 Membrane-type matrix metalloproteinase 1 Membrane-type-1 matrix metalloproteinase MMP-X1 MMP14 protein protein human Homo sapiens Human MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV limk1_human LIM domain kinase 1 LIMK1 LIMK protein protein human Homo sapiens Human MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD limk1-mt1_mmp-3 1014108 n/a 1014111 unspecified role unspecified role prey prey n/a 1014112 unspecified role unspecified role bait bait physical association physical association false false false fig. 5c mt1_mmp-limk1-1 1014108 n/a 1014111 unspecified role unspecified role bait bait n/a 1014112 unspecified role unspecified role prey prey physical association physical association false false false fig.5d limk1-mt1_mmp-1 1014109 n/a 1014111 unspecified role unspecified role neutral component neutral component n/a 1014112 unspecified role unspecified role neutral component neutral component c-term flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P53667:p.Thr508Glu mutation mutation certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false fig. 5a,5b,additional file 3 limk1-mt1_mmp-2 1014110 n/a 1014111 unspecified role unspecified role neutral component neutral component n/a 1014112 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false fig.5a,5b,6a,6b,additional files 3and 4