IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lu-2011-3 Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tcm.edu zhengz@bcm.tmc.edu Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation lu-2011-1 Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tcm.edu zhengz@bcm.tmc.edu Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation lu-2011-2 Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tcm.edu zhengz@bcm.tmc.edu Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation lu-2011-4 Three sorting nexins drive the degradation of apoptotic cells in response to PtdIns(3)P signaling. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lu N., Shen Q., Mahoney T.R., Liu X., Zhou Z. zhengz@bcm.tcm.edu zhengz@bcm.tmc.edu Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation 1-phosphatidyl-1d-myo-inositol 4-phosphate 1-phosphatidyl-1D-myo-inositol 4-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) lst4_caeel Sorting nexin lst-4 lst-4 Lateral signaling target protein 4 Y37A1B.2 protein protein caeel Caenorhabditis elegans MAQVKAEYDFQSQPNTGELSISAGEVLTVIRENIDGGWIEGRNVRGSVGLFPESYVTPYQASRPPPVLPPPLPPTSSGPPAASSRPFDDWGGASEVAAPPSYGAQHHHQPTPSVPEVTRSSYPSQNDDFDDEWTDEDDEQEPTRPNVQSSIGSNSRRDLSRSHSEHGGPDRGSNKVNKNINRFSNFVKSGVEAYVIGESKTTSQISERHEVVMNNGIIQWKPIQQYYTCIVDKPKKESKLKGLKSFIAYSITSSLTNIQRQVSRRYKHFDWLHEQLSAKYVLIPIPPLPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKDWKNGKRRAEKDEYIGGAFLNCITVPHQPLDPNNVDMQVERFQRSVKTSEEAMRVMQERMNMFQKVFAGPVKQNWQKMGSAFKTLQQSFEIDETVASRRLTEALAYTASEYHEIGQVFDAHTKNDMEPVLENLYSYKGTVQNVPDIIQVHKQAVQKFRDSEGRLSSAEAEKMKQRIDAMSYTVIAEVQHQTAEKVEDMKSTMGTYLKKQAMFYQEVATKLTSLAARYD pi3p 1-phosphatidyl-1D-myo-inositol 3-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pi5p 1-phosphatidyl-1D-myo-inositol 5-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9gyj9_caeel snx-1 CELE_C05D9.1 C05D9.1 protein protein caeel Caenorhabditis elegans MLSEEDVHTNSYAGRTVAVMEQPDLFSDDCDEINLGNEDTPPSKLRLHTTEEPKESSSPAVINSIEDHDQYVGNDNHYAQISPEPALSNFKVTMREFEKRGDGMNAYIVYKLETEVSGVVGYTKQHYETWRRFSDFLGLHGKIVEKYLAKGIVIPQPPEKSISALTKTKTNSDPAMSREVGIQRARQLERYICRLIQHPRMRNDCDVRDFLTIESDLPKAVQTAALSSFGVKKIFKNFQVVFSKMAFHMEEGDRWFEQVQSQVDELDEALRKLYTVTETLVASRRDMATSGEQLGKALSMLAACEESTSLSRALSSLTDVTENVSAVYGKQAEVDNSKFSESIYEYIMLISALKDVFGERVRAWQQWQDAQQTLARKRDQKTKIDLSAGGRNERSDQLKGEIEDTVQKMDQLEQHFIELSKAIREEVARFDADRKQDMKKMLVEYMESMIHTHTELLHLWEKFEPEANNIRV 1-phosphatidyl-1d-myo-inositol 3,4,5-trisphosphate 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dyn1_caeel Dynamin dyn-1 C02C6.1 protein protein caeel Caenorhabditis elegans MSWQNQGMQALIPVINRVQDAFSQLGTSVSFELPQIAVVGGQSAGKSSVLENFVGKDFLPRGSGIVTRRPLILQLIQDRNEYAEFLHKKGHRFVDFDAVRKEIEDETDRVTGQNKGISPHPINLRVFSPNVLNLTLIDLPGLTKVPVGDQPADIEQQIRDMILTFINRETCLILAVTPANSDLATSDALKLAKEVDPQGLRTIGVLTKLDLMDEGTDAREILENKLFTLRRGYVGVVNRGQKDIVGRKDIRAALDAERKFFISHPSYRHMADRLGTSYLQHTLNQQLTNHIRDTLPTLRDSLQKKMFAMEKDVAEYKNYQPNDPGRKTKALLQMVTQFNADIERSIEGSSAKLVSTNELSGGARINRLFHERFPFEIVKMEIDEKEMRKEIQYAIRNIHGIRVGLFTPDMAFEAIAKKQITRLKEPSLKCVDLVVNELANVIRQCADTMARYPRLRDELERIVVSHMREREQIAKQQIGLIVDYELAYMNTNHEDFIGFSNAEAKASQGQSAKKNLGNQVIRKGWLSLSNVSFVRGSKDNWFVLMSDSLSWYKDDEEKEKKYMLPLDGVKLKDIEGGFMSRNHKFALFYPDGKNIYKDYKQLELGCTNLDEIDAWKASFLRAGVYPEKQKAQEDESQQEMEDTSIDPQLERQVETIRNLVDSYMRIITKTIKDLVPKAVMHLIVNQTGEFMKDELLAHLYQCGDTDALMEESQIEAQKREEMLRMYHACKEALRIISEVNMSTLGDQPPPLPMSDYRPHPSGPSPVPRPAPAPPGGRQAPMPPRGGPGAPPPPGMRPPPGAPGGGGGMYPPLIPTRPGPGGPPPNMAPPR d9ptp5_caeel Y59A8B.22 snx-6 CELE_Y59A8B.22 protein protein caeel Caenorhabditis elegans MLGDGEEVFANPLQEASSDDVTSPPAAAADVEVSLNDDDDVTTTTTNDDTFRTARSTLNDSQNTTVVQEEKKKAEKEESYSSLADNRNHRTEEINIDMNSDEAICVDISDALSEREKVKYTVHTRTRLQEMKPETAVVREHEEFLWLHGTLEDNENYAGFIIPPAPPKPNFDSSREKLQKLGEGEATMTKEEFLKMKHDLEQDYLAQFKKTVAMHEVFLQRIAAHPVFKNDQNFRIFLQYENELSVRGKNKKEQVESFWKRFTQSADEVLLSGQKDVDEFFEKEKNYMVEYNIHIKEAAAKSEKLIAARKNVVASFSKIGDSFERIARGEPNKSLARTFAQGADAMFKLKKVESRSSNDEELKLGDTLHYFARDTQAAKDLLYRRMRCLANYEAANKNLERARAKNREIPKAEAEQSEACKKFEEITGLSKNELKELKTRRVQAFKKNLTDLAELEIKHSKAEISLLRDVVERLKSSQ 1_phosphatid-lst_4-1 1173982 n/a 1173986 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1173987 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false S7b and S7c 1_phosphatidyl-lst_4 1173982 n/a 1173987 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1173988 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false S7b and S7c 1_phosphatid-lst_4-2 1173982 n/a 1173987 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1173989 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false S7b and S7c 1_phosphatid-lst_4-3 1173982 n/a 1173987 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1173990 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false S7b and S7c 1_phosphatid-snx_1-1 1173982 n/a 1173986 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1173991 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false S7d and S7e 1_phosphatid-snx_1-2 1173982 n/a 1173991 unspecified role unspecified role prey prey purified purified px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1173992 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false S7d and S7e 1_phosphatid-snx_1-3 1173982 n/a 1173991 unspecified role unspecified role prey prey purified purified px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) n/a 1173988 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false S7d and S7e 1_phosphatid-snx_1-4 1173982 n/a 1173991 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 1173989 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false S7d and S7e 1_phosphatid-snx_1-5 1173982 n/a 1173990 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) n/a 1173991 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false px domain region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false S7d and S7e dyn_1-lst_4-1 1173983 n/a 1173993 unspecified role unspecified role bait bait n/a 1173987 unspecified role unspecified role prey prey physical association physical association false false false 5a lst_4-lst_4 1173983 n/a 1173987 unspecified role unspecified role prey prey n/a 1173987 unspecified role unspecified role bait bait physical association physical association false false false 7a snx_6-snx_1 1173983 n/a 1173991 unspecified role unspecified role prey prey n/a 1173994 unspecified role unspecified role bait bait physical association physical association false false false 7a snx_1-snx_1 1173983 n/a 1173991 unspecified role unspecified role prey prey n/a 1173991 unspecified role unspecified role bait bait physical association physical association false false false 7a snx_6-snx_6 1173983 n/a 1173994 unspecified role unspecified role prey prey n/a 1173994 unspecified role unspecified role bait bait physical association physical association false false false 7a snx_1-snx_6-1 1173983 n/a 1173994 unspecified role unspecified role prey prey n/a 1173991 unspecified role unspecified role bait bait physical association physical association false false false 7a dyn_1-lst_4-2 1173984 n/a 1173993 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1173987 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false 5b snx_1-snx_6 1173985 n/a 1173991 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 1173994 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 7B